PDB entry 3fey

View 3fey on RCSB PDB site
Description: Crystal structure of the CBC-importin alpha complex.
Class: translation, protein transport
Keywords: Cap binding complex, importin alpha, nuclear transport, mRNA transport, Nucleus, Phosphoprotein, RNA-binding, Host-virus interaction, TRANSLATION, PROTEIN TRANSPORT
Deposited on 2008-12-01, released 2009-08-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.194
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear cap-binding protein subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CBP80, NCBP, NCBP1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Nuclear cap-binding protein subunit 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CBP20, NCBP2, PIG55
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3feyb_
  • Chain 'C':
    Compound: Importin subunit alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: KPNA2, RCH1, SRP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52292 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.04: d3feyc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3feyB (B:)
    msggllkalrsdsyvelsqyrdqhfrgdneeqekllkksctlyvgnlsfytteeqiyelf
    sksgdikkiimgldkmkktacgfcfveyysradaenamryingtrlddriirtdwdagfk
    egrqygrgrsggqvrdeyrqdydagrggygklaqnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3feyB (B:)
    dsyveeqekllkksctlyvgnlsfytteeqiyelfsksgdikkiimgldtacgfcfveyy
    sradaenamryingtrlddriirtdwdagfkegrqyg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3feyC (C:)
    mnqgtvnwsvddivkginssnvenqlqatqaarkllsrekqppidniiraglipkfvsfl
    grtdcspiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgn
    iagdgsvfrdlvikygavdpllallavpdmsslacgylrnltwtlsnlcrnknpappida
    veqilptlvrllhhddpevladtcwaisyltdgpnerigmvvktgvvpqlvkllgaselp
    ivtpalraignivtgtdeqtqvvidagalavfpslltnpktniqkeatwtmsnitagrqd
    qiqqvvnhglvpflvsvlskadfktqkeavwavtnytsggtveqivylvhcgiieplmnl
    ltakdtkiilvildaisnifqaaeklgeteklsimieecggldkiealqnhenesvykas
    lsliekyfsveeeedqnvvpettsegytfqvqdgapgtfnfhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3feyC (C:)
    mnqgtvnwsvddivkginssnvenqlqatqaarkllsrekqppidniiraglipkfvsfl
    grtdcspiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgn
    iagdgsvfrdlvikygavdpllallavsslacgylrnltwtlsnlcrnknpappidaveq
    ilptlvrllhhddpevladtcwaisyltdgpnerigmvvktgvvpqlvkllgaselpivt
    palraignivtgtdeqtqvvidagalavfpslltnpktniqkeatwtmsnitagrqdqiq
    qvvnhglvpflvsvlskadfktqkeavwavtnytsggtveqivylvhcgiieplmnllta
    kdtkiilvildaisnifqaaeklgeteklsimieecggldkiealqnhenesvykaslsl
    iekyfsve