PDB entry 3fer

View 3fer on RCSB PDB site
Description: Crystal structure of n-terminal actin-binding domain from human filamin b (tandem ch-domains). northeast structural genomics consortium target hr5571a.
Class: actin binding protein
Keywords: x-ray nesg hr5571a actin-binding domain, structural genomics, psi-2, protein structure initiative, northeast structural genomics consortium, actin-binding, alternative splicing, cytoplasm, cytoskeleton, developmental protein, differentiation, disease mutation, dwarfism, myogenesis, phosphoprotein, polymorphism, actin binding protein
Deposited on 2008-11-30, released 2009-01-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-01-06, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.215
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Filamin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: FLNB, FLN1L, FLN3, TABP, TAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3fera1, d3fera2
  • Chain 'B':
    Compound: Filamin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: FLNB, FLN1L, FLN3, TABP, TAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ferb1, d3ferb2
  • Chain 'C':
    Compound: Filamin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: FLNB, FLN1L, FLN3, TABP, TAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ferc1, d3ferc2
  • Chain 'D':
    Compound: Filamin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: FLNB, FLN1L, FLN3, TABP, TAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ferd1, d3ferd2
  • Heterogens: ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ferA (A:)
    mghhhhhhshmpvtekdlaedapwkkiqqntftrwcnehlkcvnkrignlqtdlsdglrl
    iallevlsqkrmyrkyhqrptfrqmqlenvsvalefldresiklvsidskaivdgnlkli
    lglvwtlilhysismpvwedegdddakkqtpkqrllgwiqnkipylpitnfnqnwqdgka
    lgalvdscapglcpdweswdpqkpvdnareamqqaddwlgvpqvitpeeiihpdvdehsv
    mtylsqfpkaklkpgaplkpkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ferA (A:)
    pwkkiqqntftrwcnehlkcvnkrignlqtdlsdglrliallevlsqkrmyrkyhqrptf
    rqmqlenvsvalefldresiklvsidskaivdgnlklilglvwtlilhysismpvwedeg
    kqtpkqrllgwiqnkipylpitnfnqnwqdgkalgalvdscapglcpdweswdpqkpvdn
    areamqqaddwlgvpqvitpeeiihpdvdehsvmtylsqfpkaklkpgaplkpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ferB (B:)
    mghhhhhhshmpvtekdlaedapwkkiqqntftrwcnehlkcvnkrignlqtdlsdglrl
    iallevlsqkrmyrkyhqrptfrqmqlenvsvalefldresiklvsidskaivdgnlkli
    lglvwtlilhysismpvwedegdddakkqtpkqrllgwiqnkipylpitnfnqnwqdgka
    lgalvdscapglcpdweswdpqkpvdnareamqqaddwlgvpqvitpeeiihpdvdehsv
    mtylsqfpkaklkpgaplkpkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ferB (B:)
    pwkkiqqntftrwcnehlkcvnkrignlqtdlsdglrliallevlsqkrmyrkyhqrptf
    rqmqlenvsvalefldresiklvsidskaivdgnlklilglvwtlilhysismpvwedeg
    kqtpkqrllgwiqnkipylpitnfnqnwqdgkalgalvdscapglcpdweswdpqkpvdn
    areamqqaddwlgvpqvitpeeiihpdvdehsvmtylsqfpkaklkpgaplkpk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ferC (C:)
    mghhhhhhshmpvtekdlaedapwkkiqqntftrwcnehlkcvnkrignlqtdlsdglrl
    iallevlsqkrmyrkyhqrptfrqmqlenvsvalefldresiklvsidskaivdgnlkli
    lglvwtlilhysismpvwedegdddakkqtpkqrllgwiqnkipylpitnfnqnwqdgka
    lgalvdscapglcpdweswdpqkpvdnareamqqaddwlgvpqvitpeeiihpdvdehsv
    mtylsqfpkaklkpgaplkpkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ferC (C:)
    wkkiqqntftrwcnehlkcvnkrignlqtdlsdglrliallevlsqkrmyrkyhqrptfr
    qmqlenvsvalefldresiklvsidskaivdgnlklilglvwtlilhysiskqtpkqrll
    gwiqnkipylpitnfnqnwqdgkalgalvdscapglcpdweswdpqkpvdnareamqqad
    dwlgvpqvitpeeiihpdvdehsvmtylsqfpkaklkpgaplkpk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ferD (D:)
    mghhhhhhshmpvtekdlaedapwkkiqqntftrwcnehlkcvnkrignlqtdlsdglrl
    iallevlsqkrmyrkyhqrptfrqmqlenvsvalefldresiklvsidskaivdgnlkli
    lglvwtlilhysismpvwedegdddakkqtpkqrllgwiqnkipylpitnfnqnwqdgka
    lgalvdscapglcpdweswdpqkpvdnareamqqaddwlgvpqvitpeeiihpdvdehsv
    mtylsqfpkaklkpgaplkpkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ferD (D:)
    pwkkiqqntftrwcnehlkcvnkrignlqtdlsdglrliallevlsqkrmyrkyhqrptf
    rqmqlenvsvalefldresiklvsidskaivdgnlklilglvwtlilhysismpvwedeg
    kqtpkqrllgwiqnkipylpitnfnqnwqdgkalgalvdscapglcpdweswdpqkpvdn
    areamqqaddwlgvpqvitpeeiihpdvdehsvmtylsqfpkaklkpgaplkpk