PDB entry 3fdj

View 3fdj on RCSB PDB site
Description: The structure of a DegV family protein from Eubacterium eligens.
Class: structural genomics, unknown function
Keywords: DegV, gut microbiome, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, unknown function
Deposited on 2008-11-25, released 2009-02-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DegV family protein
    Species: Eubacterium eligens [TaxId:39485]
    Gene: ASSEMBLY.20070618:0-0:0-0 (zvnW5vjFOAACMF8NLOPRFTmWH60:01:1-275)
    Database cross-references and differences (RAF-indexed):
    • PDB 3FDJ (Start-277)
    Domains in SCOPe 2.07: d3fdja_
  • Heterogens: P6G, EDO, PG4, NA, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fdjA (A:)
    snamrlvadsacdikelrgmvfkavpltistdneefcddgqldihrmldilekhkgrsyt
    acpgidawleafgdddeifvvtitagmsgtynsamaaravyleehpqakvrvidskstgp
    qmriileqlqqmieegkkfeeidgaidaymqktrlfcslkslhnlaqngrvskvvasaae
    vlgisvigtasshgtleaigkcrgdkkllvklqallddagyeggklrichvenealadki
    admikqaygttdvcvykagglcsyyaerggiilscetk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fdjA (A:)
    amrlvadsacdikelrgmvfkavpltistdneefcddgqldihrmldilekhkgrsytac
    pgidawleafgdddeifvvtitagmsgtynsamaaravyleehpqakvrvidskstgpqm
    riileqlqqmieegkkfeeidgaidaymqktrlfcslkslhnlaqngrvskvvasaaevl
    gisvigtasshgtleaigkcrgdkkllvklqallddagyeggklrichvenealadkiad
    mikqaygttdvcvykagglcsyyaerggiilscetk