PDB entry 3fcy

View 3fcy on RCSB PDB site
Description: Crystal Structure of Acetyl Xylan Esterase 1 from Thermoanaerobacterium sp. JW/SL YS485
Class: hydrolase
Keywords: alpha/beta hydrolase, carbohydrate esterase, CE7, Thermoanaerobacterium sp.
Deposited on 2008-11-24, released 2009-11-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-11-17, with a file datestamp of 2009-11-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.184
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Xylan esterase 1
    Species: Thermoanaerobacterium sp. 'JW/SL YS485' [TaxId:60708]
    Gene: axe1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fcya_
  • Chain 'B':
    Compound: Xylan esterase 1
    Species: Thermoanaerobacterium sp. 'JW/SL YS485' [TaxId:60708]
    Gene: axe1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fcyb_
  • Chain 'C':
    Compound: Xylan esterase 1
    Species: Thermoanaerobacterium sp. 'JW/SL YS485' [TaxId:60708]
    Gene: axe1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fcyc_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fcyA (A:)
    mkhhhhhhpmsdydipttenlyfqgamglfdmplqklreytgtnpcpedfdeywnralde
    mrsvdpkielkessfqvsfaecydlyftgvrgarihakyikpktegkhpalirfhgyssn
    sgdwndklnyvaagftvvamdvrgqggqsqdvggvtgntlnghiirgldddadnmlfrhi
    fldtaqlagivmnmpevdedrvgvmgpsqggglslacaaleprvrkvvseypflsdykrv
    wdldlaknayqeitdyfrlfdprherenevftklgyidvknlakrikgdvlmcvglmdqv
    cppstvfaaynniqskkdikvypdyghepmrgfgdlamqfmlelys
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fcyA (A:)
    fdmplqklreytgtnpcpedfdeywnraldemrsvdpkielkessfqvsfaecydlyftg
    vrgarihakyikpktegkhpalirfhgyssnsgdwndklnyvaagftvvamdvrgqggqs
    qdvggvtgntlnghiirgldddadnmlfrhifldtaqlagivmnmpevdedrvgvmgpsq
    ggglslacaaleprvrkvvseypflsdykrvwdldlaknayqeitdyfrlfdprherene
    vftklgyidvknlakrikgdvlmcvglmdqvcppstvfaaynniqskkdikvypdyghep
    mrgfgdlamqfmlelys
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fcyB (B:)
    mkhhhhhhpmsdydipttenlyfqgamglfdmplqklreytgtnpcpedfdeywnralde
    mrsvdpkielkessfqvsfaecydlyftgvrgarihakyikpktegkhpalirfhgyssn
    sgdwndklnyvaagftvvamdvrgqggqsqdvggvtgntlnghiirgldddadnmlfrhi
    fldtaqlagivmnmpevdedrvgvmgpsqggglslacaaleprvrkvvseypflsdykrv
    wdldlaknayqeitdyfrlfdprherenevftklgyidvknlakrikgdvlmcvglmdqv
    cppstvfaaynniqskkdikvypdyghepmrgfgdlamqfmlelys
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fcyB (B:)
    fdmplqklreytgtnpcpedfdeywnraldemrsvdpkielkessfqvsfaecydlyftg
    vrgarihakyikpktegkhpalirfhgyssnsgdwndklnyvaagftvvamdvrgqggqs
    qdvggvtgntlnghiirgldddadnmlfrhifldtaqlagivmnmpevdedrvgvmgpsq
    ggglslacaaleprvrkvvseypflsdykrvwdldlaknayqeitdyfrlfdprherene
    vftklgyidvknlakrikgdvlmcvglmdqvcppstvfaaynniqskkdikvypdyghep
    mrgfgdlamqfmlelys
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3fcyC (C:)
    mkhhhhhhpmsdydipttenlyfqgamglfdmplqklreytgtnpcpedfdeywnralde
    mrsvdpkielkessfqvsfaecydlyftgvrgarihakyikpktegkhpalirfhgyssn
    sgdwndklnyvaagftvvamdvrgqggqsqdvggvtgntlnghiirgldddadnmlfrhi
    fldtaqlagivmnmpevdedrvgvmgpsqggglslacaaleprvrkvvseypflsdykrv
    wdldlaknayqeitdyfrlfdprherenevftklgyidvknlakrikgdvlmcvglmdqv
    cppstvfaaynniqskkdikvypdyghepmrgfgdlamqfmlelys
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fcyC (C:)
    fdmplqklreytgtnpcpedfdeywnraldemrsvdpkielkessfqvsfaecydlyftg
    vrgarihakyikpktegkhpalirfhgyssnsgdwndklnyvaagftvvamdvrgqggqs
    qdvggvtgntlnghiirgldddadnmlfrhifldtaqlagivmnmpevdedrvgvmgpsq
    ggglslacaaleprvrkvvseypflsdykrvwdldlaknayqeitdyfrlfdprherene
    vftklgyidvknlakrikgdvlmcvglmdqvcppstvfaaynniqskkdikvypdyghep
    mrgfgdlamqfmlelys