PDB entry 3fcp

View 3fcp on RCSB PDB site
Description: Crystal structure of Muconate lactonizing enzyme from Klebsiella pneumoniae
Class: isomerase
Keywords: structural genomics, NYSGRC,target 9450e, Muconate lactonizing enzyme, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, ISOMERASE
Deposited on 2008-11-22, released 2008-12-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2008-12-02, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.229
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-Ala-D/L-Glu epimerase, a muconate lactonizing enzyme
    Species: Klebsiella pneumoniae subsp. pneumoniae MGH 78578 [TaxId:272620]
    Gene: KPN78578_18450, KPN_01875
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6T9N5 (3-372)
      • expression tag (2)
    Domains in SCOPe 2.06: d3fcpa1, d3fcpa2, d3fcpa3
  • Chain 'B':
    Compound: L-Ala-D/L-Glu epimerase, a muconate lactonizing enzyme
    Species: Klebsiella pneumoniae subsp. pneumoniae MGH 78578 [TaxId:272620]
    Gene: KPN78578_18450, KPN_01875
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fcpb1, d3fcpb2
  • Chain 'C':
    Compound: L-Ala-D/L-Glu epimerase, a muconate lactonizing enzyme
    Species: Klebsiella pneumoniae subsp. pneumoniae MGH 78578 [TaxId:272620]
    Gene: KPN78578_18450, KPN_01875
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fcpc1, d3fcpc2
  • Chain 'D':
    Compound: L-Ala-D/L-Glu epimerase, a muconate lactonizing enzyme
    Species: Klebsiella pneumoniae subsp. pneumoniae MGH 78578 [TaxId:272620]
    Gene: KPN78578_18450, KPN_01875
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fcpd1, d3fcpd2
  • Chain 'E':
    Compound: L-Ala-D/L-Glu epimerase, a muconate lactonizing enzyme
    Species: Klebsiella pneumoniae subsp. pneumoniae MGH 78578 [TaxId:272620]
    Gene: KPN78578_18450, KPN_01875
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fcpe1, d3fcpe2
  • Chain 'F':
    Compound: L-Ala-D/L-Glu epimerase, a muconate lactonizing enzyme
    Species: Klebsiella pneumoniae subsp. pneumoniae MGH 78578 [TaxId:272620]
    Gene: KPN78578_18450, KPN_01875
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fcpf1, d3fcpf2
  • Chain 'G':
    Compound: L-Ala-D/L-Glu epimerase, a muconate lactonizing enzyme
    Species: Klebsiella pneumoniae subsp. pneumoniae MGH 78578 [TaxId:272620]
    Gene: KPN78578_18450, KPN_01875
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fcpg1, d3fcpg2
  • Chain 'H':
    Compound: L-Ala-D/L-Glu epimerase, a muconate lactonizing enzyme
    Species: Klebsiella pneumoniae subsp. pneumoniae MGH 78578 [TaxId:272620]
    Gene: KPN78578_18450, KPN_01875
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6T9N5 (3-372)
      • expression tag (2)
    Domains in SCOPe 2.06: d3fcph1, d3fcph2, d3fcph3
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fcpA (A:)
    msltatveqieswivdvptirphklsmttmgcqslvivrltrsdgicgigeattigglsy
    gvespeaissaithyltpllkgqpadnlnaltarmngaikgntfaksaietalldaqgka
    lglpvsallggalqtalpvlwtlasgdtakdiaegekllaegrhrafklkigarelatdl
    rhtraivealgdrasirvdvnqawdaatgakgcrelaamgvdlieqpvsahdnaalvrls
    qqietailadeavataydgyqlaqqgftgayalkiakaggpnsvlalarvaqaagiglyg
    gtmlegtvgtvaslhawstlplqwgtemfgplllkddivsvpltfadgqvalpqtpglgv
    eldedklhfytrqeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fcpA (A:)
    ltatveqieswivdvpticqslvivrltrsdgicgigeattigglsygvespeaissait
    hyltpllkgqpadnlnaltarmngaikgntfaksaietalldaqgkalglpvsallggal
    qtalpvlwtlasgdtakdiaegekllarafklkigarelatdlrhtraivealgdrasir
    vdvnqawdaatgakgcrelaamgvdlieqpvsahdnaalvrlsqqietailadeavatay
    dgyqlaqqgftgayalkiakaggpnsvlalarvaqaagiglyggtmlegtvgtvaslhaw
    stlplqwgtemfgplllkddivsvpltfadgqvalpqtpglgveldedklhfytrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fcpB (B:)
    msltatveqieswivdvptirphklsmttmgcqslvivrltrsdgicgigeattigglsy
    gvespeaissaithyltpllkgqpadnlnaltarmngaikgntfaksaietalldaqgka
    lglpvsallggalqtalpvlwtlasgdtakdiaegekllaegrhrafklkigarelatdl
    rhtraivealgdrasirvdvnqawdaatgakgcrelaamgvdlieqpvsahdnaalvrls
    qqietailadeavataydgyqlaqqgftgayalkiakaggpnsvlalarvaqaagiglyg
    gtmlegtvgtvaslhawstlplqwgtemfgplllkddivsvpltfadgqvalpqtpglgv
    eldedklhfytrqeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fcpB (B:)
    atveqieswivdvpticqslvivrltrsdgicgigeattigglsygvespeaissaithy
    ltpllkgqpadnlnaltarmngaikgntfaksaietalldaqgkalglpvsallggalqt
    alpvlwtlasgdtakdiaegekllarafklkigarelatdlrhtraivealgdrasirvd
    vnqawdaatgakgcrelaamgvdlieqpvsahdnaalvrlsqqietailadeavataydg
    yqlaqqgftgayalkiakaggpnsvlalarvaqaagiglyggtmlegtvgtvaslhawst
    lplqwgtemfgplllkddivsvpltfadgqvalpqtpglgveldedklhfytrq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3fcpC (C:)
    msltatveqieswivdvptirphklsmttmgcqslvivrltrsdgicgigeattigglsy
    gvespeaissaithyltpllkgqpadnlnaltarmngaikgntfaksaietalldaqgka
    lglpvsallggalqtalpvlwtlasgdtakdiaegekllaegrhrafklkigarelatdl
    rhtraivealgdrasirvdvnqawdaatgakgcrelaamgvdlieqpvsahdnaalvrls
    qqietailadeavataydgyqlaqqgftgayalkiakaggpnsvlalarvaqaagiglyg
    gtmlegtvgtvaslhawstlplqwgtemfgplllkddivsvpltfadgqvalpqtpglgv
    eldedklhfytrqeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fcpC (C:)
    atveqieswivdvpticqslvivrltrsdgicgigeattigglsygvespeaissaithy
    ltpllkgqpadnlnaltarmngaikgntfaksaietalldaqgkalglpvsallggalqt
    alpvlwtlasgdtakdiaegekllarafklkigarelatdlrhtraivealgdrasirvd
    vnqawdaatgakgcrelaamgvdlieqpvsahdnaalvrlsqqietailadeavataydg
    yqlaqqgftgayalkiakaggpnsvlalarvaqaagiglyggtmlegtvgtvaslhawst
    lplqwgtemfgplllkddivsvpltfadgqvalpqtpglgveldedklhfytrq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3fcpD (D:)
    msltatveqieswivdvptirphklsmttmgcqslvivrltrsdgicgigeattigglsy
    gvespeaissaithyltpllkgqpadnlnaltarmngaikgntfaksaietalldaqgka
    lglpvsallggalqtalpvlwtlasgdtakdiaegekllaegrhrafklkigarelatdl
    rhtraivealgdrasirvdvnqawdaatgakgcrelaamgvdlieqpvsahdnaalvrls
    qqietailadeavataydgyqlaqqgftgayalkiakaggpnsvlalarvaqaagiglyg
    gtmlegtvgtvaslhawstlplqwgtemfgplllkddivsvpltfadgqvalpqtpglgv
    eldedklhfytrqeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fcpD (D:)
    atveqieswivdvpticqslvivrltrsdgicgigeattigglsygvespeaissaithy
    ltpllkgqpadnlnaltarmngaikgntfaksaietalldaqgkalglpvsallggalqt
    alpvlwtlasgdtakdiaegekllarafklkigarelatdlrhtraivealgdrasirvd
    vnqawdaatgakgcrelaamgvdlieqpvsahdnaalvrlsqqietailadeavataydg
    yqlaqqgftgayalkiakaggpnsvlalarvaqaagiglyggtmlegtvgtvaslhawst
    lplqwgtemfgplllkddivsvpltfadgqvalpqtpglgveldedklhfytrq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3fcpE (E:)
    msltatveqieswivdvptirphklsmttmgcqslvivrltrsdgicgigeattigglsy
    gvespeaissaithyltpllkgqpadnlnaltarmngaikgntfaksaietalldaqgka
    lglpvsallggalqtalpvlwtlasgdtakdiaegekllaegrhrafklkigarelatdl
    rhtraivealgdrasirvdvnqawdaatgakgcrelaamgvdlieqpvsahdnaalvrls
    qqietailadeavataydgyqlaqqgftgayalkiakaggpnsvlalarvaqaagiglyg
    gtmlegtvgtvaslhawstlplqwgtemfgplllkddivsvpltfadgqvalpqtpglgv
    eldedklhfytrqeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fcpE (E:)
    tatveqieswivdvpticqslvivrltrsdgicgigeattigglsygvespeaissaith
    yltpllkgqpadnlnaltarmngaikgntfaksaietalldaqgkalglpvsallggalq
    talpvlwtlasgdtakdiaegekllarafklkigarelatdlrhtraivealgdrasirv
    dvnqawdaatgakgcrelaamgvdlieqpvsahdnaalvrlsqqietailadeavatayd
    gyqlaqqgftgayalkiakaggpnsvlalarvaqaagiglyggtmlegtvgtvaslhaws
    tlplqwgtemfgplllkddivsvpltfadgqvalpqtpglgveldedklhfytrq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3fcpF (F:)
    msltatveqieswivdvptirphklsmttmgcqslvivrltrsdgicgigeattigglsy
    gvespeaissaithyltpllkgqpadnlnaltarmngaikgntfaksaietalldaqgka
    lglpvsallggalqtalpvlwtlasgdtakdiaegekllaegrhrafklkigarelatdl
    rhtraivealgdrasirvdvnqawdaatgakgcrelaamgvdlieqpvsahdnaalvrls
    qqietailadeavataydgyqlaqqgftgayalkiakaggpnsvlalarvaqaagiglyg
    gtmlegtvgtvaslhawstlplqwgtemfgplllkddivsvpltfadgqvalpqtpglgv
    eldedklhfytrqeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fcpF (F:)
    atveqieswivdvpticqslvivrltrsdgicgigeattigglsygvespeaissaithy
    ltpllkgqpadnlnaltarmngaikgntfaksaietalldaqgkalglpvsallggalqt
    alpvlwtlasgdtakdiaegekllarafklkigarelatdlrhtraivealgdrasirvd
    vnqawdaatgakgcrelaamgvdlieqpvsahdnaalvrlsqqietailadeavataydg
    yqlaqqgftgayalkiakaggpnsvlalarvaqaagiglyggtmlegtvgtvaslhawst
    lplqwgtemfgplllkddivsvpltfadgqvalpqtpglgveldedklhfytrq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3fcpG (G:)
    msltatveqieswivdvptirphklsmttmgcqslvivrltrsdgicgigeattigglsy
    gvespeaissaithyltpllkgqpadnlnaltarmngaikgntfaksaietalldaqgka
    lglpvsallggalqtalpvlwtlasgdtakdiaegekllaegrhrafklkigarelatdl
    rhtraivealgdrasirvdvnqawdaatgakgcrelaamgvdlieqpvsahdnaalvrls
    qqietailadeavataydgyqlaqqgftgayalkiakaggpnsvlalarvaqaagiglyg
    gtmlegtvgtvaslhawstlplqwgtemfgplllkddivsvpltfadgqvalpqtpglgv
    eldedklhfytrqeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fcpG (G:)
    atveqieswivdvpticqslvivrltrsdgicgigeattigglsygvespeaissaithy
    ltpllkgqpadnlnaltarmngaikgntfaksaietalldaqgkalglpvsallggalqt
    alpvlwtlasgdtakdiaegekllarafklkigarelatdlrhtraivealgdrasirvd
    vnqawdaatgakgcrelaamgvdlieqpvsahdnaalvrlsqqietailadeavataydg
    yqlaqqgftgayalkiakaggpnsvlalarvaqaagiglyggtmlegtvgtvaslhawst
    lplqwgtemfgplllkddivsvpltfadgqvalpqtpglgveldedklhfytrq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3fcpH (H:)
    msltatveqieswivdvptirphklsmttmgcqslvivrltrsdgicgigeattigglsy
    gvespeaissaithyltpllkgqpadnlnaltarmngaikgntfaksaietalldaqgka
    lglpvsallggalqtalpvlwtlasgdtakdiaegekllaegrhrafklkigarelatdl
    rhtraivealgdrasirvdvnqawdaatgakgcrelaamgvdlieqpvsahdnaalvrls
    qqietailadeavataydgyqlaqqgftgayalkiakaggpnsvlalarvaqaagiglyg
    gtmlegtvgtvaslhawstlplqwgtemfgplllkddivsvpltfadgqvalpqtpglgv
    eldedklhfytrqeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fcpH (H:)
    ltatveqieswivdvpticqslvivrltrsdgicgigeattigglsygvespeaissait
    hyltpllkgqpadnlnaltarmngaikgntfaksaietalldaqgkalglpvsallggal
    qtalpvlwtlasgdtakdiaegekllarafklkigarelatdlrhtraivealgdrasir
    vdvnqawdaatgakgcrelaamgvdlieqpvsahdnaalvrlsqqietailadeavatay
    dgyqlaqqgftgayalkiakaggpnsvlalarvaqaagiglyggtmlegtvgtvaslhaw
    stlplqwgtemfgplllkddivsvpltfadgqvalpqtpglgveldedklhfytrq