PDB entry 3fca

View 3fca on RCSB PDB site
Description: Genetic Incorporation of a Metal-ion Chelating Amino Acid into proteins as biophysical probe
Class: transferase
Keywords: Phasing, Heavy metal, unnatural amino acid, metal binding, TRANSFERASE
Deposited on 2008-11-21, released 2009-02-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine synthase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 3FCA (0-290)
    Domains in SCOPe 2.07: d3fcaa_
  • Chain 'B':
    Compound: Cysteine synthase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 3FCA (0-290)
    Domains in SCOPe 2.07: d3fcab_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fcaA (A:)
    mmerligstpivrldsidsrixlkleknnpggsvkdrpalfmildaekrgllkngivept
    sgnmgiaiamigakrghrviltmpetmsverrkvlkmlgaelvltpgelgmkgavekale
    isretgahmlnqfenpynvyshqfttgpeilkqmdyqidafvagvgtggtisgvgrvlkg
    ffgngvkivavepakspvlsggqpgkhaiqgigagfvpkildrsvidevitvedeeayem
    arylakkegllvgissganvaaalkvaqklgpdarvvtvapdhaerylsil
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fcaB (B:)
    mmerligstpivrldsidsrixlkleknnpggsvkdrpalfmildaekrgllkngivept
    sgnmgiaiamigakrghrviltmpetmsverrkvlkmlgaelvltpgelgmkgavekale
    isretgahmlnqfenpynvyshqfttgpeilkqmdyqidafvagvgtggtisgvgrvlkg
    ffgngvkivavepakspvlsggqpgkhaiqgigagfvpkildrsvidevitvedeeayem
    arylakkegllvgissganvaaalkvaqklgpdarvvtvapdhaerylsil