PDB entry 3fc6

View 3fc6 on RCSB PDB site
Description: hRXRalpha & mLXRalpha with an indole Pharmacophore, SB786875
Class: transcription
Keywords: Liver X receptor, nuclear hormone receptors, agonists, epoxycholesterol, DNA-binding, Host-virus interaction, Metal-binding, Nucleus, Polymorphism, Receptor, Transcription, Transcription regulation, Ubl conjugation, Zinc, Zinc-finger
Deposited on 2008-11-21, released 2009-02-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-03-03, with a file datestamp of 2009-02-27.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.201
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinoic acid receptor RXR-alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fc6a_
  • Chain 'B':
    Compound: Nr1h3 protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fc6b_
  • Chain 'C':
    Compound: Retinoic acid receptor RXR-alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fc6c_
  • Chain 'D':
    Compound: Nr1h3 protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fc6d_
  • Heterogens: REA, LX2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fc6A (A:)
    mkkgsanedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlv
    ewakriphfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsa
    gvgaifdrvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasl
    eayckhkypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaphq
    mt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fc6A (A:)
    sanedmpverileaelavdpvtnicqaadkqlftlvewakriphfselplddqvillrag
    wnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdmqmdk
    telgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllrlpa
    lrsiglkclehlfffkldtflmemlea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fc6B (B:)
    mrgshhhhhhgmaslvprgsvlpqlspeqlgmieklvaaqqqcnrrsfsdrlrvtpwpia
    pdpqsrearqqrfahftelaivsvqeivdfakqlpgflqlsredqiallktsaievmlle
    tsrrynpgsesitflkdfsynredfakaglqvefinpifefsramnelqlndaefallia
    isifsadrpnvqdqlqverlqhtyvealhayvsinhphdplmfprmlmklvslrtlssvh
    seqvfalrlqdkklppllseiwdvhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fc6B (B:)
    qlspeqlgmieklvaaqqqcnrrsfsdrlrvtpwpiapdpqsrearqqrfahftelaivs
    vqeivdfakqlpgflqlsredqiallktsaievmlletsrrynpgsesitflkdfsynre
    dfakaglqvefinpifefsramnelqlndaefalliaisifsadrpnvqdqlqverlqht
    yvealhayvsinhphdplmfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwd
    v
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3fc6C (C:)
    mkkgsanedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlv
    ewakriphfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsa
    gvgaifdrvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasl
    eayckhkypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaphq
    mt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fc6C (C:)
    sanedmpverileaelavepdpvtnicqaadkqlftlvewakriphfselplddqvillr
    agwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdmqm
    dktelgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllrl
    palrsiglkcledtflmemlea
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3fc6D (D:)
    mrgshhhhhhgmaslvprgsvlpqlspeqlgmieklvaaqqqcnrrsfsdrlrvtpwpia
    pdpqsrearqqrfahftelaivsvqeivdfakqlpgflqlsredqiallktsaievmlle
    tsrrynpgsesitflkdfsynredfakaglqvefinpifefsramnelqlndaefallia
    isifsadrpnvqdqlqverlqhtyvealhayvsinhphdplmfprmlmklvslrtlssvh
    seqvfalrlqdkklppllseiwdvhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fc6D (D:)
    qlspeqlgmieklvaaqqqcnrrsfsdrlrvtpwpiapdpqsrearqqrfahftelaivs
    vqeivdfakqlpgflqlsredqiallktsaievmlletsrrynpgsesitflkdfsynre
    dfakaglqvefinpifefsramnelqlndaefalliaisifsadrpnvqdqlqverlqht
    yvealhayvsinhphdplmfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwd
    v