PDB entry 3fb6

View 3fb6 on RCSB PDB site
Description: KcsA Potassium channel in the partially open state with 16 A opening at T112
Class: membrane protein/metal transport
Keywords: kcsa, open, inactivation, potassium channel, Cell membrane, Ion transport, Ionic channel, Membrane, Transmembrane, Transport, Voltage-gated channel, membrane protein-metal transport COMPLEX
Deposited on 2008-11-18, released 2010-05-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-02-09, with a file datestamp of 2011-02-04.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.248
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody fab fragment heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3FB6 (0-218)
  • Chain 'B':
    Compound: antibody fab fragment light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3FB6 (0-211)
    Domains in SCOPe 2.06: d3fb6b1, d3fb6b2
  • Chain 'C':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Gene: kcsA, skc1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334
      • engineered (4)
      • engineered (69)
    Domains in SCOPe 2.06: d3fb6c_
  • Heterogens: K

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fb6B (B:)
    dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
    rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3fb6C (C:)
    gsalqwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygd
    lypvtlwgrcvavvvmvagitsfglvtaalatwfvgqeqqqqgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fb6C (C:)
    qwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdlypv
    tlwgrcvavvvmvagitsfglvtaalatwf