PDB entry 3fb1

View 3fb1 on RCSB PDB site
Description: Crystal Structure of Purine Nucleoside Phosphorylase in Complex with Ribose-1-Phosphate
Class: transferase
Keywords: Purine nucleoside phsophorylase, ribose-1-phosphate, Glycosyltransferase, Transferase
Deposited on 2008-11-18, released 2009-11-24
The last revision prior to the SCOPe 2.01 freeze date was dated 2012-01-25, with a file datestamp of 2012-01-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.177
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine-nucleoside phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: SmPNP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3fb1a_
  • Chain 'B':
    Compound: purine-nucleoside phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: SmPNP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3fb1b_
  • Chain 'C':
    Compound: purine-nucleoside phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: SmPNP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3fb1c_
  • Heterogens: R1P, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fb1A (A:)
    mhesvtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpq
    tsvvghsgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaag
    glnrslklgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqva
    eengfgnlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfav
    slvtnisvldvesdlkpnheevlatgaqraelmqswfekiieklpkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fb1A (A:)
    svtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpqtsh
    sgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaagglnrsl
    klgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqvaeengfg
    nlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfavslvtni
    svldvesdlkpnheevlatgaqraelmqswfekiieklpkd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fb1B (B:)
    mhesvtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpq
    tsvvghsgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaag
    glnrslklgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqva
    eengfgnlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfav
    slvtnisvldvesdlkpnheevlatgaqraelmqswfekiieklpkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fb1B (B:)
    svtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpqtvv
    ghsgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaagglnr
    slklgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqvaeeng
    fgnlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfavslvt
    nisvldvesaqraelmqswfekiieklpkd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3fb1C (C:)
    mhesvtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpq
    tsvvghsgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaag
    glnrslklgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqva
    eengfgnlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfav
    slvtnisvldvesdlkpnheevlatgaqraelmqswfekiieklpkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fb1C (C:)
    esvtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpqts
    vvghsgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaaggl
    nrslklgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqvaee
    ngfgnlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfavsl
    vtnisvldvesdlkpnheevlatgaqraelmqswfekiieklpkd