PDB entry 3fap

View 3fap on RCSB PDB site
Description: atomic structures of the rapamycin analogs in complex with both human fkbp12 and frb domain of frap
Class: cell cycle
Keywords: fkbp12, frap, rapamycin, complex, gene therapy
Deposited on 1999-05-06, released 2000-09-13
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.207
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fk506-binding protein
    Species: HOMO SAPIENS
    Gene: HUMAN HIPPOCAMPAL CDNA LIBRARY SOURCE 8 (CLONTECH, PALO ALTO, CA)
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d3fapa_
  • Chain 'B':
    Compound: fkbp12-rapamycin associated protein
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d3fapb_
  • Heterogens: ARD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fapA (A:)
    gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
    egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fapB (B:)
    vailwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrdl
    meaqewcrkymksgnvkdltqawdlyyhvfrris