PDB entry 3fak

View 3fak on RCSB PDB site
Description: Structural and Functional Analysis of a Hormone-Sensitive Lipase like EstE5 from a Metagenome Library
Class: hydrolase
Keywords: HSL, EstE5, esterase, lipase, HYDROLASE
Deposited on 2008-11-17, released 2009-02-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-10, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.214
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Esterase/lipase
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3faka_
  • Heterogens: CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fakA (A:)
    masmtggqqmgrgmagpeivklkkilrekavppgtevpldvmrkgmekvafkaaddiqve
    qvtvagcaaewvrapgcqagkailylhgggyvmgsinthrsmvgeisrasqaaallldyr
    lapehpfpaavedgvaayrwlldqgfkpqhlsisgdsaggglvlavlvsardqglpmpas
    aipispwadmtctndsfktraeadpmvapgginkmaarylngadakhpyaspnfanlkgl
    ppllihvgrdevllddsikldakakadgvkstleiwddmihvwhafhpmlpegkqaivrv
    gefmreqwaalaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fakA (A:)
    magpeivklkkilrekavppgtevpldvmrkgmekvafkaaddiqveqvtvagcaaewvr
    apgcqagkailylhgggyvmgsinthrsmvgeisrasqaaallldyrlapehpfpaaved
    gvaayrwlldqgfkpqhlsisgdsaggglvlavlvsardqglpmpasaipispwadmtct
    ndsfktraeadpmvapgginkmaarylngadakhpyaspnfanlkglppllihvgrdevl
    lddsikldakakadgvkstleiwddmihvwhafhpmlpegkqaivrvgefmreqwaa