PDB entry 3fai

View 3fai on RCSB PDB site
Description: The Di Zinc Carbapenemase CphA N220G mutant
Class: hydrolase
Keywords: HYDROLASE, Antibiotic resistance, Metal-binding
Deposited on 2008-11-17, released 2009-09-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.14
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Aeromonas hydrophila [TaxId:644]
    Gene: cphA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26918 (0-226)
      • engineered (164)
    Domains in SCOPe 2.08: d3faia_
  • Heterogens: ZN, CL, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3faiA (A:)
agmsltqvsgpvyvvednyyvqensmvyfgakgvtvvgatwtpdtarelhklikrvsrkp
vlevintnyhtdraggnaywksigakvvstrqtrdlmksdwaeivaftrkglpeypdlpl
vlpnvvhdgdftlqegkvrafyagpahtpdgifvyfpdeqvlyggcilkeklgnlsfadv
kaypqtlerlkamklpiktvigghdsplhgpelidhyealikaapqs