PDB entry 3fa4

View 3fa4 on RCSB PDB site
Description: Crystal structure of 2,3-dimethylmalate lyase, a PEP mutase/isocitrate lyase superfamily member, triclinic crystal form
Class: lyase
Keywords: alpha/beta barrel, HELIX SWAPPING, LYASE
Deposited on 2008-11-14, released 2009-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: 0.204
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2,3-dimethylmalate lyase
    Species: Aspergillus niger [TaxId:5061]
    Gene: An07g08390
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fa4a_
  • Chain 'B':
    Compound: 2,3-dimethylmalate lyase
    Species: Aspergillus niger [TaxId:5061]
    Gene: An07g08390
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fa4b_
  • Chain 'C':
    Compound: 2,3-dimethylmalate lyase
    Species: Aspergillus niger [TaxId:5061]
    Gene: An07g08390
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fa4c_
  • Chain 'D':
    Compound: 2,3-dimethylmalate lyase
    Species: Aspergillus niger [TaxId:5061]
    Gene: An07g08390
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fa4d_
  • Chain 'E':
    Compound: 2,3-dimethylmalate lyase
    Species: Aspergillus niger [TaxId:5061]
    Gene: An07g08390
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fa4e_
  • Chain 'F':
    Compound: 2,3-dimethylmalate lyase
    Species: Aspergillus niger [TaxId:5061]
    Gene: An07g08390
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fa4f_
  • Chain 'G':
    Compound: 2,3-dimethylmalate lyase
    Species: Aspergillus niger [TaxId:5061]
    Gene: An07g08390
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fa4g_
  • Chain 'H':
    Compound: 2,3-dimethylmalate lyase
    Species: Aspergillus niger [TaxId:5061]
    Gene: An07g08390
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fa4h_
  • Chain 'I':
    Compound: 2,3-dimethylmalate lyase
    Species: Aspergillus niger [TaxId:5061]
    Gene: An07g08390
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fa4i_
  • Chain 'J':
    Compound: 2,3-dimethylmalate lyase
    Species: Aspergillus niger [TaxId:5061]
    Gene: An07g08390
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fa4j_
  • Chain 'K':
    Compound: 2,3-dimethylmalate lyase
    Species: Aspergillus niger [TaxId:5061]
    Gene: An07g08390
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fa4k_
  • Chain 'L':
    Compound: 2,3-dimethylmalate lyase
    Species: Aspergillus niger [TaxId:5061]
    Gene: An07g08390
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fa4l_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fa4A (A:)
    pmvtaatslrralenpdsfivapgvydglsarvalsagfdalymtgagtaasvhgqadlg
    ictlndmranaemisnispstpviadadtgyggpimvartteqysrsgvaafhiedqvqt
    krcghlagkilvdtdtyvtriraavqarqrigsdivviartdslqthgyeesvarlraar
    dagadvgflegitsremarqviqdlagwplllnmvehgatpsisaaeakemgfriiifpf
    aalgpavaamreameklkrdgipgldkemtpqmlfrvcgldesmkvdaqaggaafdggvd
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fa4A (A:)
    pmvtaatslrralenpdsfivapgvydglsarvalsagfdalymtgagtaasvhgqadlg
    ictlndmranaemisnispstpviadadtgyggpimvartteqysrsgvaafhiedqvqt
    gkilvdtdtyvtriraavqarqrigsdivviartdslqthgyeesvarlraardagadvg
    flegitsremarqviqdlagwplllnmvehgatpsisaaeakemgfriiifpfaalgpav
    aamreameklkrdgipgldkemtpqmlfrvcgldesmkvdaqag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fa4B (B:)
    pmvtaatslrralenpdsfivapgvydglsarvalsagfdalymtgagtaasvhgqadlg
    ictlndmranaemisnispstpviadadtgyggpimvartteqysrsgvaafhiedqvqt
    krcghlagkilvdtdtyvtriraavqarqrigsdivviartdslqthgyeesvarlraar
    dagadvgflegitsremarqviqdlagwplllnmvehgatpsisaaeakemgfriiifpf
    aalgpavaamreameklkrdgipgldkemtpqmlfrvcgldesmkvdaqaggaafdggvd
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fa4B (B:)
    pmvtaatslrralenpdsfivapgvydglsarvalsagfdalymtgagtaasvhgqadlg
    ictlndmranaemisnispstpviadadtgyggpimvartteqysrsgvaafhiedqvqt
    kkilvdtdtyvtriraavqarqrigsdivviartdslqthgyeesvarlraardagadvg
    flegitsremarqviqdlagwplllnmvehgatpsisaaeakemgfriiifpfaalgpav
    aamreameklkrdgipgldkemtpqmlfrvcgldesmkvdaqaggaaf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3fa4C (C:)
    pmvtaatslrralenpdsfivapgvydglsarvalsagfdalymtgagtaasvhgqadlg
    ictlndmranaemisnispstpviadadtgyggpimvartteqysrsgvaafhiedqvqt
    krcghlagkilvdtdtyvtriraavqarqrigsdivviartdslqthgyeesvarlraar
    dagadvgflegitsremarqviqdlagwplllnmvehgatpsisaaeakemgfriiifpf
    aalgpavaamreameklkrdgipgldkemtpqmlfrvcgldesmkvdaqaggaafdggvd
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fa4C (C:)
    mvtaatslrralenpdsfivapgvydglsarvalsagfdalymtgagtaasvhgqadlgi
    ctlndmranaemisnispstpviadadtgyggpimvartteqysrsgvaafhiedqvqtk
    rkilvdtdtyvtriraavqarqrigsdivviartdslqthgyeesvarlraardagadvg
    flegitsremarqviqdlagwplllnmvehgatpsisaaeakemgfriiifpfaalgpav
    aamreameklkrdgipgldkemtpqmlfrvcgldesmkvdaqag
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3fa4D (D:)
    pmvtaatslrralenpdsfivapgvydglsarvalsagfdalymtgagtaasvhgqadlg
    ictlndmranaemisnispstpviadadtgyggpimvartteqysrsgvaafhiedqvqt
    krcghlagkilvdtdtyvtriraavqarqrigsdivviartdslqthgyeesvarlraar
    dagadvgflegitsremarqviqdlagwplllnmvehgatpsisaaeakemgfriiifpf
    aalgpavaamreameklkrdgipgldkemtpqmlfrvcgldesmkvdaqaggaafdggvd
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fa4D (D:)
    pmvtaatslrralenpdsfivapgvydglsarvalsagfdalymtgagtaasvhgqadlg
    ictlndmranaemisnispstpviadadtgyggpimvartteqysrsgvaafhiedqvqt
    kilvdtdtyvtriraavqarqrigsdivviartdslqthgyeesvarlraardagadvgf
    legitsremarqviqdlagwplllnmvehgatpsisaaeakemgfriiifpfaalgpava
    amreameklkrdgipgldkemtpqmlfrvcgldesmkvdaqagg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3fa4E (E:)
    pmvtaatslrralenpdsfivapgvydglsarvalsagfdalymtgagtaasvhgqadlg
    ictlndmranaemisnispstpviadadtgyggpimvartteqysrsgvaafhiedqvqt
    krcghlagkilvdtdtyvtriraavqarqrigsdivviartdslqthgyeesvarlraar
    dagadvgflegitsremarqviqdlagwplllnmvehgatpsisaaeakemgfriiifpf
    aalgpavaamreameklkrdgipgldkemtpqmlfrvcgldesmkvdaqaggaafdggvd
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fa4E (E:)
    pmvtaatslrralenpdsfivapgvydglsarvalsagfdalymtgagtaasvhgqadlg
    ictlndmranaemisnispstpviadadtgyggpimvartteqysrsgvaafhiedqvqt
    gkilvdtdtyvtriraavqarqrigsdivviartdslqthgyeesvarlraardagadvg
    flegitsremarqviqdlagwplllnmvehgatpsisaaeakemgfriiifpfaalgpav
    aamreameklkrdgipgldkemtpqmlfrvcgldesmkvdaqagga
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3fa4F (F:)
    pmvtaatslrralenpdsfivapgvydglsarvalsagfdalymtgagtaasvhgqadlg
    ictlndmranaemisnispstpviadadtgyggpimvartteqysrsgvaafhiedqvqt
    krcghlagkilvdtdtyvtriraavqarqrigsdivviartdslqthgyeesvarlraar
    dagadvgflegitsremarqviqdlagwplllnmvehgatpsisaaeakemgfriiifpf
    aalgpavaamreameklkrdgipgldkemtpqmlfrvcgldesmkvdaqaggaafdggvd
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fa4F (F:)
    pmvtaatslrralenpdsfivapgvydglsarvalsagfdalymtgagtaasvhgqadlg
    ictlndmranaemisnispstpviadadtgyggpimvartteqysrsgvaafhiedqvqt
    kgkilvdtdtyvtriraavqarqrigsdivviartdslqthgyeesvarlraardagadv
    gflegitsremarqviqdlagwplllnmvehgatpsisaaeakemgfriiifpfaalgpa
    vaamreameklkrdgipgldkemtpqmlfrvcgldesmkvdaqag
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3fa4G (G:)
    pmvtaatslrralenpdsfivapgvydglsarvalsagfdalymtgagtaasvhgqadlg
    ictlndmranaemisnispstpviadadtgyggpimvartteqysrsgvaafhiedqvqt
    krcghlagkilvdtdtyvtriraavqarqrigsdivviartdslqthgyeesvarlraar
    dagadvgflegitsremarqviqdlagwplllnmvehgatpsisaaeakemgfriiifpf
    aalgpavaamreameklkrdgipgldkemtpqmlfrvcgldesmkvdaqaggaafdggvd
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fa4G (G:)
    pmvtaatslrralenpdsfivapgvydglsarvalsagfdalymtgagtaasvhgqadlg
    ictlndmranaemisnispstpviadadtgyggpimvartteqysrsgvaafhiedqvqt
    gkilvdtdtyvtriraavqarqrigsdivviartdslqthgyeesvarlraardagadvg
    flegitsremarqviqdlagwplllnmvehgatpsisaaeakemgfriiifpfaalgpav
    aamreameklkrdgipgldkemtpqmlfrvcgldesmkvdaqag
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3fa4H (H:)
    pmvtaatslrralenpdsfivapgvydglsarvalsagfdalymtgagtaasvhgqadlg
    ictlndmranaemisnispstpviadadtgyggpimvartteqysrsgvaafhiedqvqt
    krcghlagkilvdtdtyvtriraavqarqrigsdivviartdslqthgyeesvarlraar
    dagadvgflegitsremarqviqdlagwplllnmvehgatpsisaaeakemgfriiifpf
    aalgpavaamreameklkrdgipgldkemtpqmlfrvcgldesmkvdaqaggaafdggvd
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fa4H (H:)
    pmvtaatslrralenpdsfivapgvydglsarvalsagfdalymtgagtaasvhgqadlg
    ictlndmranaemisnispstpviadadtgyggpimvartteqysrsgvaafhiedqvqk
    ilvdtdtyvtriraavqarqrigsdivviartdslqthgyeesvarlraardagadvgfl
    egitsremarqviqdlagwplllnmvehgatpsisaaeakemgfriiifpfaalgpavaa
    mreameklkrdgipgldkemtpqmlfrvcgldesmkvdaqag
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3fa4I (I:)
    pmvtaatslrralenpdsfivapgvydglsarvalsagfdalymtgagtaasvhgqadlg
    ictlndmranaemisnispstpviadadtgyggpimvartteqysrsgvaafhiedqvqt
    krcghlagkilvdtdtyvtriraavqarqrigsdivviartdslqthgyeesvarlraar
    dagadvgflegitsremarqviqdlagwplllnmvehgatpsisaaeakemgfriiifpf
    aalgpavaamreameklkrdgipgldkemtpqmlfrvcgldesmkvdaqaggaafdggvd
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fa4I (I:)
    mvtaatslrralenpdsfivapgvydglsarvalsagfdalymtgagtaasvhgqadlgi
    ctlndmranaemisnispstpviadadtgyggpimvartteqysrsgvaafhiedqvqtk
    ilvdtdtyvtriraavqarqrigsdivviartdslqthgyeesvarlraardagadvgfl
    egitsremarqviqdlagwplllnmvehgatpsisaaeakemgfriiifpfaalgpavaa
    mreameklkrdgipgldkemtpqmlfrvcgldesmkvdaqag
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3fa4J (J:)
    pmvtaatslrralenpdsfivapgvydglsarvalsagfdalymtgagtaasvhgqadlg
    ictlndmranaemisnispstpviadadtgyggpimvartteqysrsgvaafhiedqvqt
    krcghlagkilvdtdtyvtriraavqarqrigsdivviartdslqthgyeesvarlraar
    dagadvgflegitsremarqviqdlagwplllnmvehgatpsisaaeakemgfriiifpf
    aalgpavaamreameklkrdgipgldkemtpqmlfrvcgldesmkvdaqaggaafdggvd
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fa4J (J:)
    mvtaatslrralenpdsfivapgvydglsarvalsagfdalymtgagtaasvhgqadlgi
    ctlndmranaemisnispstpviadadtgyggpimvartteqysrsgvaafhiedqvqil
    vdtdtyvtriraavqarqrigsdivviartdslqthgyeesvarlraardagadvgfleg
    itsremarqviqdlagwplllnmvehgatpsisaaeakemgfriiifpfaalgpavaamr
    eameklkrdgipgldkemtpqmlfrvcgldesmkvdaqag
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3fa4K (K:)
    pmvtaatslrralenpdsfivapgvydglsarvalsagfdalymtgagtaasvhgqadlg
    ictlndmranaemisnispstpviadadtgyggpimvartteqysrsgvaafhiedqvqt
    krcghlagkilvdtdtyvtriraavqarqrigsdivviartdslqthgyeesvarlraar
    dagadvgflegitsremarqviqdlagwplllnmvehgatpsisaaeakemgfriiifpf
    aalgpavaamreameklkrdgipgldkemtpqmlfrvcgldesmkvdaqaggaafdggvd
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fa4K (K:)
    vtaatslrralenpdsfivapgvydglsarvalsagfdalymtgagtaasvhgqadlgic
    tlndmranaemisnispstpviadadtgyggpimvartteqysrsgvaafhiedqvqilv
    dtdtyvtriraavqarqrigsdivviartdslqthgyeesvarlraardagadvgflegi
    tsremarqviqdlagwplllnmvehgatpsisaaeakemgfriiifpfaalgpavaamre
    ameklkrdgipgldkemtpqmlfrvcgldesmkvdaqagg
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3fa4L (L:)
    pmvtaatslrralenpdsfivapgvydglsarvalsagfdalymtgagtaasvhgqadlg
    ictlndmranaemisnispstpviadadtgyggpimvartteqysrsgvaafhiedqvqt
    krcghlagkilvdtdtyvtriraavqarqrigsdivviartdslqthgyeesvarlraar
    dagadvgflegitsremarqviqdlagwplllnmvehgatpsisaaeakemgfriiifpf
    aalgpavaamreameklkrdgipgldkemtpqmlfrvcgldesmkvdaqaggaafdggvd
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fa4L (L:)
    taatslrralenpdsfivapgvydglsarvalsagfdalymtgagtaasvhgqadlgict
    lndmranaemisnispstpviadadtgyggpimvartteqysrsgvaafhiedqvqtkrc
    ghlagkilvdtdtyvtriraavqarqrigsdivviartdslqthgyeesvarlraardag
    advgflegitsremarqviqdlagwplllnmvehgatpsisaaeakemgfriiifpfaal
    gpavaamreameklkrdgipgldkemtpqmlfrvcgldesmkvdaqag