PDB entry 3f8w

View 3f8w on RCSB PDB site
Description: Crystal structure of Schistosoma mansoni purine nucleoside phosphorylase in complex with adenosine
Class: transferase
Keywords: Purine Nucleoside Phosphorylase, Schistosoma, adenosine, Glycosyltransferase, Transferase
Deposited on 2008-11-13, released 2009-11-24
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-01-26, with a file datestamp of 2010-01-22.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.176
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine-nucleoside phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: SmPNP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3f8wa_
  • Chain 'B':
    Compound: purine-nucleoside phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: SmPNP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3f8wb_
  • Chain 'C':
    Compound: purine-nucleoside phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: SmPNP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3f8wc_
  • Heterogens: ADN, SO4, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f8wA (A:)
    mhesvtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpq
    tsvvghsgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaag
    glnrslklgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqva
    eengfgnlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfav
    slvtnisvldvesdlkpnheevlatgaqraelmqswfekiieklpkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f8wA (A:)
    svtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpqtsh
    sgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaagglnrsl
    klgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqvaeengfg
    nlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfavslvtni
    svldvesdlkpnheevlatgaqraelmqswfekiieklpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3f8wB (B:)
    mhesvtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpq
    tsvvghsgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaag
    glnrslklgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqva
    eengfgnlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfav
    slvtnisvldvesdlkpnheevlatgaqraelmqswfekiieklpkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f8wB (B:)
    svtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpqtsv
    vghsgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaaggln
    rslklgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqvaeen
    gfgnlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfavslv
    tnisvldvesdlkpnheevlatgaqraelmqswfekiieklpkd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3f8wC (C:)
    mhesvtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpq
    tsvvghsgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaag
    glnrslklgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqva
    eengfgnlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfav
    slvtnisvldvesdlkpnheevlatgaqraelmqswfekiieklpkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f8wC (C:)
    vtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpqghsg
    nlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaagglnrslkl
    gdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqvaeengfgnl
    vhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfavslvtnisv
    ldvesdlkpnheevlatgaqraelmqswfekiieklpkd