PDB entry 3f8n

View 3f8n on RCSB PDB site
Description: Crystal structure of PerR-Zn-Mn
Class: DNA Binding Protein
Keywords: DNA binding protein, helix-turn-helix, Cytoplasm, DNA-binding, Manganese, Oxidation, Repressor, Transcription, Transcription regulation, Zinc
Deposited on 2008-11-13, released 2009-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-30, with a file datestamp of 2009-06-26.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: 0.277
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxide operon regulator
    Species: Bacillus subtilis [TaxId:1423]
    Gene: perR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3f8na_
  • Chain 'B':
    Compound: Peroxide operon regulator
    Species: Bacillus subtilis [TaxId:1423]
    Gene: perR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3f8nb_
  • Heterogens: MN, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f8nA (A:)
    maahelkealetlketgvritpqrhaileylvnsmahptaddiykalegkfpnmsvatvy
    nnlrvfresglvkeltygdassrfdfvtsdhyhaicencgkivdfhypgldeveqlaahv
    tgfkvshhrleiygvcqecskkenh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f8nA (A:)
    helkealetlketgvritpqrhaileylvnsmahptaddiykalegkfpnmsvatvynnl
    rvfresglvkeltygdassrfdfvtsdhyhaicencgkivdfhypgldeveqlaahvtgf
    kvshhrleiygvcqecs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3f8nB (B:)
    maahelkealetlketgvritpqrhaileylvnsmahptaddiykalegkfpnmsvatvy
    nnlrvfresglvkeltygdassrfdfvtsdhyhaicencgkivdfhypgldeveqlaahv
    tgfkvshhrleiygvcqecskkenh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f8nB (B:)
    helkealetlketgvritpqrhaileylvnsmahptaddiykalegkfpnmsvatvynnl
    rvfresglvkeltygdassrfdfvtsdhyhaicencgkivdfhypgldeveqlaahvtgf
    kvshhrleiygvcqec