PDB entry 3f8c

View 3f8c on RCSB PDB site
Description: Crystal structure of multidrug binding transcriptional regulator LmrR complexed with Hoechst 33342
Class: transcription regulator
Keywords: Winged helix turn helix, TRANSCRIPTION REGULATOR
Deposited on 2008-11-12, released 2008-12-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-04-09, with a file datestamp of 2014-04-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.212
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator, PadR-like family
    Species: Lactococcus lactis subsp. cremoris [TaxId:416870]
    Gene: lmrR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3f8ca_
  • Heterogens: HT1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f8cA (A:)
    maeipkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekd
    giissywgdesqggrrkyyrlteighenmrlafeswsrvdkiienleankkseaiksrws
    hpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f8cA (A:)
    eipkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekdgi
    issywgdegrrkyyrlteighenmrlafeswsrvdkiienlea