PDB entry 3f8b

View 3f8b on RCSB PDB site
Description: Crystal structure of the multidrug binding transcriptional regulator LmrR in drug free state
Class: transcription regulator
Keywords: Winged helix turn helix, TRANSCRIPTION REGULATOR
Deposited on 2008-11-12, released 2008-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-09, with a file datestamp of 2014-04-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.221
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator, PadR-like family
    Species: Lactococcus lactis subsp. cremoris [TaxId:416870]
    Gene: lmrR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3f8ba_
  • Chain 'B':
    Compound: Transcriptional regulator, PadR-like family
    Species: Lactococcus lactis subsp. cremoris [TaxId:416870]
    Gene: lmrR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3f8bb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f8bA (A:)
    maeipkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekd
    giissywgdesqggrrkyyrlteighenmrlafeswsrvdkiienleankkseaik
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f8bA (A:)
    pkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekdgiis
    sywgdgrrkyyrlteighenmrlafeswsrvdkiienlean
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3f8bB (B:)
    maeipkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekd
    giissywgdesqggrrkyyrlteighenmrlafeswsrvdkiienleankkseaik
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f8bB (B:)
    pkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekdgiis
    sywgdesqggrrkyyrlteighenmrlafeswsrvdkiienlean