PDB entry 3f88

View 3f88 on RCSB PDB site
Description: glycogen synthase Kinase 3beta inhibitor complex
Class: transferase
Keywords: enzyme, protein kinase, inhibitor, Alternative splicing, ATP-binding, Kinase, Nucleotide-binding, Phosphoprotein, Serine/threonine-protein kinase, Transferase, Wnt signaling pathway
Deposited on 2008-11-11, released 2009-03-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.204
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: GSK3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3f88a_
  • Chain 'B':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: GSK3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3f88b_
  • Heterogens: 3HT, 2HT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f88A (A:)
    skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
    nrelqimrkldhcnivrlryffyssgekkdvvylnlvldyvpetvyrvarhysrakqtlp
    viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv
    syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg
    tptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltplea
    cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f88A (A:)
    skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
    nrelqimrkldhcnivrlryffyssvylnlvldyvpetvyrvarhysrakqtlpviyvkl
    ymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsr
    yyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreq
    iremnpnefkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsffde
    lrdpnvklpngrdtpalfnfttqelssnpplatilipphar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3f88B (B:)
    skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
    nrelqimrkldhcnivrlryffyssgekkdvvylnlvldyvpetvyrvarhysrakqtlp
    viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv
    syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg
    tptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltplea
    cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f88B (B:)
    skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
    nrelqimrkldhcnivrlryffyssvylnlvldyvpetvyrvarhysrakqtlpviyvkl
    ymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsr
    yyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreq
    iremnpnefkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsffde
    lrdpnvklpngrdtpalfnfttqelssnpplatilipphar