PDB entry 3f7z

View 3f7z on RCSB PDB site
Description: X-ray Co-Crystal Structure of Glycogen Synthase Kinase 3beta in Complex with an Inhibitor
Class: transferase
Keywords: enzyme, protein kinase, inhibitor co-crystal structure, ATP-binding, Kinase, Nucleotide-binding, Phosphoprotein, Serine/threonine-protein kinase, Transferase, Wnt signaling pathway
Deposited on 2008-11-10, released 2009-03-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.206
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: GSK3B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49841 (1-349)
      • expression tag (0)
    Domains in SCOPe 2.03: d3f7za_
  • Chain 'B':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: GSK3B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49841 (1-349)
      • expression tag (0)
    Domains in SCOPe 2.03: d3f7zb_
  • Heterogens: 34O, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f7zA (A:)
    lskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrf
    knrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtl
    pviyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepn
    vsyicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvl
    gtptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltple
    acahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f7zA (A:)
    lskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrf
    knrelqimrkldhcnivrlryffyssgeevylnlvldyvpetvyrvarhysrakqtlpvi
    yvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsy
    icsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtp
    treqiremnpnqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsffdel
    rdpnvklpngrdtpalfnfttqelssnpplatilipphar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3f7zB (B:)
    lskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrf
    knrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtl
    pviyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepn
    vsyicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvl
    gtptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltple
    acahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f7zB (B:)
    lskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrf
    knrelqimrkldhcnivrlryffyssvylnlvldyvpetvyrvarhysrakqtlpviyvk
    lymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyics
    ryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptre
    qiremnpnytpqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsffdel
    rdpnvklpngrdtpalfnfttqelssnpplatilipphar