PDB entry 3f7p

View 3f7p on RCSB PDB site
Description: Crystal structure of a complex between integrin beta4 and plectin
Class: structural protein/cell adhesion
Keywords: INTEGRIN, PLAKIN, HEMIDESMOSOME, CELL ADHESION, EPIDERMOLYSIS BULLOSA, Actin-binding, Alternative splicing, Coiled coil, Cytoplasm, Cytoskeleton, Disease mutation, Phosphoprotein, Structural protein, Glycoprotein, Membrane, Polymorphism, Receptor, Transmembrane, STRUCTURAL PROTEIN/CELL ADHESION COMPLEX
Deposited on 2008-11-10, released 2009-03-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-04-28, with a file datestamp of 2009-04-24.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.207
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Plectin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PLEC-1 (Isoform 1C), PLEC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3f7pa1, d3f7pa2
  • Chain 'B':
    Compound: Plectin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PLEC-1 (Isoform 1C), PLEC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3f7pb1, d3f7pb2
  • Chain 'C':
    Compound: Integrin beta-4
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGB4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3f7pc1, d3f7pc2
  • Chain 'D':
    Compound: Integrin beta-4
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGB4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3f7pd1, d3f7pd2
  • Chain 'E':
    Compound: Integrin beta-4
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGB4
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, PEG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f7pA (A:)
    gshmsgedaevravsedvsngssgspspgdtlpwnlgktqrsrrsgggagsngsvldpae
    raviriaderdrvqkktftkwvnkhlikaqrhisdlyedlrdghnlisllevlsgdslpr
    ekgrmrfhklqnvqialdylrhrqvklvnirnddiadgnpkltlgliwtiilhfqisdiq
    vsgqsedmtakeklllwsqrmvegyqglrcdnftsswrdgrlfnaiihrhkpllidmnkv
    yrqtnlenldqafsvaerdlgvtrlldpedvdvpqpdeksiityvsslydamprvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f7pA (A:)
    viriaderdrvqkktftkwvnkhlikaqrhisdlyedlrdghnlisllevlsgdslprek
    grmrfhklqnvqialdylrhrqvklvnirnddiadgnpkltlgliwtiilhfqisdiqvs
    gqsedmtakeklllwsqrmvegyqglrcdnftsswrdgrlfnaiihrhkpllidmnkvyr
    qtnlenldqafsvaerdlgvtrlldpedvdvpqpdeksiityvsslydamp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3f7pB (B:)
    gshmsgedaevravsedvsngssgspspgdtlpwnlgktqrsrrsgggagsngsvldpae
    raviriaderdrvqkktftkwvnkhlikaqrhisdlyedlrdghnlisllevlsgdslpr
    ekgrmrfhklqnvqialdylrhrqvklvnirnddiadgnpkltlgliwtiilhfqisdiq
    vsgqsedmtakeklllwsqrmvegyqglrcdnftsswrdgrlfnaiihrhkpllidmnkv
    yrqtnlenldqafsvaerdlgvtrlldpedvdvpqpdeksiityvsslydamprvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f7pB (B:)
    viriderdrvqkktftkwvnkhlikaqrhisdlyedlrdghnlisllevlsgdslprekg
    rmrfhklqnvqialdylrhrqvklvnirnddiadgnpkltlgliwtiilhfqisdiqvsg
    qsedmtakeklllwsqrmvegyqglrcdnftsswrdgrlfnaiihrhkpllidmnkvyrq
    tnlenldqafsvaerdlgvtrlldpedvdvpqpdeksiityvsslydamp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3f7pC (C:)
    gshdlgapqnpnakaagsrkihfnwlppsgkpmgyrvkywiqgdseseahlldskvpsve
    ltnlypycdyemkvcaygaqgegpysslvscrthqevpsepgrlafnvvsstvtqlswae
    paetngeitayevcyglvnddnrpigpmkkvlvdnpknrmllienlresqpyrytvkarn
    gagwgpereaiinlatqpkrpmsipiipdipivdaqsgedydsflmysddvlrspsgsqr
    psvsddte
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f7pC (C:)
    lgapqnpnakaagsrkihfnwlppsgkpmgyrvkywiqgdseseahlldskvpsveltnl
    ypycdyemkvcaygaqgegpysslvscrthqevpsepgrlafnvvsstvtqlswaepaet
    ngeitayevcyglvnddnrpigpmkkvlvdnpknrmllienlresqpyrytvkarngagw
    gpereaiinlatqmsipiip
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3f7pD (D:)
    gshdlgapqnpnakaagsrkihfnwlppsgkpmgyrvkywiqgdseseahlldskvpsve
    ltnlypycdyemkvcaygaqgegpysslvscrthqevpsepgrlafnvvsstvtqlswae
    paetngeitayevcyglvnddnrpigpmkkvlvdnpknrmllienlresqpyrytvkarn
    gagwgpereaiinlatqpkrpmsipiipdipivdaqsgedydsflmysddvlrspsgsqr
    psvsddte
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f7pD (D:)
    dlgapqnpnakaagsrkihfnwlppsgkpmgyrvkywiqgdseseahlldskvpsveltn
    lypycdyemkvcaygaqgegpysslvscrthqevpsepgrlafnvvsstvtqlswaepae
    tngeitayevcyglvnddnrpigpmkkvlvdnpknrmllienlresqpyrytvkarngag
    wgpereaiinlatiip
    

  • Chain 'E':
    No sequence available.