PDB entry 3f7n

View 3f7n on RCSB PDB site
Description: Crystal Structure of CheY triple mutant F14E, N59M, E89L complexed with BeF3- and Mn2+
Class: signaling protein
Keywords: Response Regulator, Receiver Domain, BeF3, Two-Component Signal Transduction, Chemotaxis, Flagellar rotation, Magnesium, Metal-binding, Phosphoprotein, Two-component regulatory system, SIGNALING PROTEIN
Deposited on 2008-11-09, released 2009-09-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.173
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chemotaxis protein cheY
    Species: Escherichia coli [TaxId:83333]
    Gene: b1882, cheY, JW1871
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AE67 (0-127)
      • engineered (12)
      • engineered (57)
      • engineered (87)
    Domains in SCOPe 2.05: d3f7na_
  • Chain 'B':
    Compound: Chemotaxis protein cheY
    Species: Escherichia coli [TaxId:83333]
    Gene: b1882, cheY, JW1871
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AE67 (0-127)
      • engineered (12)
      • engineered (57)
      • engineered (87)
    Domains in SCOPe 2.05: d3f7nb_
  • Heterogens: MN, BEF, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3f7nA (A:)
    adkelkflvvddestmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwmmp
    nmdglellktiradgamsalpvlmvtalakkeniiaaaqagasgyvvkpftaatleekln
    kifeklgm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3f7nB (B:)
    adkelkflvvddestmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwmmp
    nmdglellktiradgamsalpvlmvtalakkeniiaaaqagasgyvvkpftaatleekln
    kifeklgm