PDB entry 3f7b

View 3f7b on RCSB PDB site
Description: Crystal Structure of soluble domain of CA4 in complex with small molecule.
Class: lyase
Keywords: Structure-based drug design. Small molecule complex. CO-CRYSTAL., Cell membrane, Disease mutation, Glycoprotein, GPI-anchor, Lipoprotein, Lyase, Membrane, Metal-binding, Retinitis pigmentosa, Sensory transduction, Vision, Zinc
Deposited on 2008-11-07, released 2009-09-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-05-12, with a file datestamp of 2010-05-07.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.194
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: CA4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3f7ba_
  • Chain 'B':
    Compound: Carbonic anhydrase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: CA4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3f7bb_
  • Heterogens: ZN, AG5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f7bA (A:)
    aeshwcyevqaessnypclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkk
    qtwtvqnnghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfame
    mhivhekekgtsrnvkeaqdpedeiavlaflveagtqvnegfqplvealsnipkpemstt
    maesslldllpkeeklrhyfrylgslttptcdekvvwtvfrepiqlhreqilafsqklyy
    dkeqtvsmkdnvrplqqlgqrtviks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f7bA (A:)
    eshwcyevqaessnypclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkkq
    twtvqnnghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfamem
    hivhekekgtspedeiavlaflveagtqvnegfqplvealsnipkpemsttmaesslldl
    lpkeeklrhyfrylgslttptcdekvvwtvfrepiqlhreqilafsqklyydkeqtvsmk
    dnvrplqqlgqrtviks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3f7bB (B:)
    aeshwcyevqaessnypclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkk
    qtwtvqnnghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfame
    mhivhekekgtsrnvkeaqdpedeiavlaflveagtqvnegfqplvealsnipkpemstt
    maesslldllpkeeklrhyfrylgslttptcdekvvwtvfrepiqlhreqilafsqklyy
    dkeqtvsmkdnvrplqqlgqrtviks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f7bB (B:)
    wcyevqaespclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkkqtwtvqn
    nghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfamemhivhek
    epedeiavlaflveagtqvnegfqplvealsnipkpemsttmaesslldllpkeeklrhy
    frylgslttptcdekvvwtvfrepiqlhreqilafsqklyydkeqtvsmkdnvrplqqlg
    qrtviks