PDB entry 3f75

View 3f75 on RCSB PDB site
Description: Activated Toxoplasma gondii cathepsin L (TgCPL) in complex with its propeptide
Class: hydrolase
Keywords: MEDICAL STRUCTURAL GENOMICS OF PATHOGENIC PROTOZOA, MSGPP, cysteine protease, parasite, protozoa, Hydrolase, Thiol protease
Deposited on 2008-11-07, released 2008-11-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-31, with a file datestamp of 2013-07-26.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.167
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cathepsin L protease
    Species: TOXOPLASMA GONDII [TaxId:383379]
    Gene: CPL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3f75a_
  • Chain 'P':
    Compound: Cathepsin L propeptide
    Species: TOXOPLASMA GONDII [TaxId:383379]
    Gene: CPL
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, BR, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f75A (A:)
    nvlpselpagvdwrsrgcvtpvkdqrdcgscwafsttgalegahcaktgklvslseqelm
    dcsraegnqscsggemndafqyvldsggicsedaypylardeecraqscekvvkilgfkd
    vprrseaamkaalakspvsiaieadqmpfqfyhegvfdascgtdldhgvllvgygtdkes
    kkdfwimknswgtgwgrdgymymamhkgeegqcgllldasfpvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f75A (A:)
    vlpselpagvdwrsrgcvtpvkdqrdcgscwafsttgalegahcaktgklvslseqelmd
    csraegnqscsggemndafqyvldsggicsedaypylardeecraqscekvvkilgfkdv
    prrseaamkaalakspvsiaieadqmpfqfyhegvfdascgtdldhgvllvgygtdkesk
    kdfwimknswgtgwgrdgymymamhkgeegqcgllldasfpvm
    

  • Chain 'P':
    No sequence available.