PDB entry 3f74

View 3f74 on RCSB PDB site
Description: Crystal structure of wild type LFA1 I domain
Class: cell adhesion
Keywords: integrin, LFA1, I domain, inactive conformation, wild type, Cell adhesion, Glycoprotein, Magnesium, Membrane, Receptor, Transmembrane
Deposited on 2008-11-07, released 2009-06-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.147
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Integrin alpha-L
    Species: Homo sapiens [TaxId:9606]
    Gene: CD11A, integrin LFA1, ITGAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20701 (1-180)
      • variant (62)
    Domains in SCOPe 2.03: d3f74a_
  • Chain 'B':
    Compound: Integrin alpha-L
    Species: Homo sapiens [TaxId:9606]
    Gene: CD11A, integrin LFA1, ITGAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20701 (1-180)
      • variant (62)
    Domains in SCOPe 2.03: d3f74b_
  • Chain 'C':
    Compound: Integrin alpha-L
    Species: Homo sapiens [TaxId:9606]
    Gene: CD11A, integrin LFA1, ITGAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20701 (1-180)
      • variant (62)
    Domains in SCOPe 2.03: d3f74c_
  • Heterogens: GOL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f74A (A:)
    mgnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdy
    vkwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsg
    nidaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkki
    y
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f74A (A:)
    gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
    kwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
    idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3f74B (B:)
    mgnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdy
    vkwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsg
    nidaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkki
    y
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f74B (B:)
    gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
    kwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
    idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3f74C (C:)
    mgnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdy
    vkwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsg
    nidaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkki
    y
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f74C (C:)
    gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
    kwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
    idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy