PDB entry 3f72

View 3f72 on RCSB PDB site
Description: Crystal Structure of the Staphylococcus aureus pI258 CadC Metal Binding Site 2 Mutant
Class: DNA binding protein, gene regulation
Keywords: Cadmium repressor protein, zinc binding site, dimerization site 2 mutant, Cadmium resistance, DNA-binding, Plasmid, Transcription, Transcription regulation, DNA BINDING PROTEIN, METAL BINDING PROTEIN, GENE REGULATION
Deposited on 2008-11-07, released 2009-04-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-06-30, with a file datestamp of 2009-06-26.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.24
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cadmium efflux system accessory protein
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20047
      • engineered (10)
      • engineered (100)
      • engineered (102)
    Domains in SCOPe 2.01: d3f72a_
  • Chain 'B':
    Compound: Cadmium efflux system accessory protein
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20047
      • engineered (10)
      • engineered (100)
      • engineered (102)
    Domains in SCOPe 2.01: d3f72b_
  • Chain 'C':
    Compound: Cadmium efflux system accessory protein
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20047
      • engineered (10)
      • engineered (100)
      • engineered (102)
    Domains in SCOPe 2.01: d3f72c_
  • Chain 'D':
    Compound: Cadmium efflux system accessory protein
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20047
      • engineered (10)
      • engineered (100)
      • engineered (102)
    Domains in SCOPe 2.01: d3f72d_
  • Chain 'E':
    Compound: Cadmium efflux system accessory protein
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20047
      • engineered (10)
      • engineered (100)
      • engineered (102)
    Domains in SCOPe 2.01: d3f72e_
  • Chain 'F':
    Compound: Cadmium efflux system accessory protein
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20047
      • engineered (10)
      • engineered (100)
      • engineered (102)
    Domains in SCOPe 2.01: d3f72f_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f72A (A:)
    mkkkdtceifgydeekvnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvc
    dianilgvtianashhlrtlykqgvvnfrkegklalyslggeairqimmialahkkevkv
    nv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f72A (A:)
    ifgydeekvnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvcdianilgv
    tianashhlrtlykqgvvnfrkgklalyslggeairqimmialahkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3f72B (B:)
    mkkkdtceifgydeekvnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvc
    dianilgvtianashhlrtlykqgvvnfrkegklalyslggeairqimmialahkkevkv
    nv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f72B (B:)
    fgydeekvnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvcdianilgvt
    ianashhlrtlykqgvvnfrkegklalyslggeairqimmialahkke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3f72C (C:)
    mkkkdtceifgydeekvnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvc
    dianilgvtianashhlrtlykqgvvnfrkegklalyslggeairqimmialahkkevkv
    nv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f72C (C:)
    gydeekvnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvcdianilgvti
    anashhlrtlykqgvvnfrklalyslggeairqimmialahkk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3f72D (D:)
    mkkkdtceifgydeekvnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvc
    dianilgvtianashhlrtlykqgvvnfrkegklalyslggeairqimmialahkkevkv
    nv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f72D (D:)
    fgydeekvnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvcdianilgvt
    ianashhlrtlykqgvvnfrlyslggeairqimmialahk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3f72E (E:)
    mkkkdtceifgydeekvnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvc
    dianilgvtianashhlrtlykqgvvnfrkegklalyslggeairqimmialahkkevkv
    nv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f72E (E:)
    gydeekvnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvcdianilgvti
    anashhlrtlykqgvvnfalyslggeairqimmialahkke
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3f72F (F:)
    mkkkdtceifgydeekvnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvc
    dianilgvtianashhlrtlykqgvvnfrkegklalyslggeairqimmialahkkevkv
    nv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f72F (F:)
    fgydeekvnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvcdianilgvt
    ianashhlrtlykqgvvnfrkyslggeairqimmialahkke