PDB entry 3f6x

View 3f6x on RCSB PDB site
Description: c-Src kinase domain in complex with small molecule inhibitor
Class: transferase
Keywords: Kinase, ATP-Binding, Alternative splicing, Lipoprotein, Myristate, Nucleotide-binding, Phosphoprotein, Proto-oncogene, SH2 domain, SH3 domain, Transferase, Tyrosine-protein kinase
Deposited on 2008-11-06, released 2008-12-09
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-03, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.234
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3f6xa_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3f6xb_
  • Chain 'C':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3f6xc_
  • Chain 'D':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3f6xd_
  • Heterogens: IHH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f6xA (A:)
    ghmqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaf
    lqeaqvmkklrheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdma
    aqiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpik
    wtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppec
    peslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f6xA (A:)
    lakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlspeaflqeaqvmkklrh
    eklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayver
    mnyvhrdlraanilvgenlvckvadfglarliekfpikwtapeaalygrftiksdvwsfg
    illtelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerptf
    eylqafledyftstepqyqpgenl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3f6xB (B:)
    ghmqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaf
    lqeaqvmkklrheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdma
    aqiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpik
    wtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppec
    peslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f6xB (B:)
    lakdaweipreslrlevklgqgcgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmk
    klrheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgma
    yvermnyvhrdlraanilvgenlvckvadfglarlikfpikwtapeaalygrftiksdvw
    sfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeer
    ptfeylqafledyftstepqyqpgenl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3f6xC (C:)
    ghmqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaf
    lqeaqvmkklrheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdma
    aqiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpik
    wtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppec
    peslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f6xC (C:)
    lakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkppeaflqeaqvmkklr
    heklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayve
    rmnyvhrdlraanilvgenlvckvadfglarliekfpikwtapeaalygrftiksdvwsf
    gilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerpt
    feylqafledyftstepqyqpgenl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3f6xD (D:)
    ghmqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaf
    lqeaqvmkklrheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdma
    aqiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpik
    wtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppec
    peslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f6xD (D:)
    kdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkk
    lrheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmay
    vermnyvhrdlraanilvgenlvckvadfglarliekfpikwtapeaalygrftiksdvw
    sfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeer
    ptfeylqafledyftstepqyqpgenl