PDB entry 3f66

View 3f66 on RCSB PDB site
Description: Human c-Met Kinase in complex with quinoxaline inhibitor
Class: Transferase
Keywords: c-Met, protein kinase, quinoxaline, Alternative splicing; ATP-binding; Chromosomal rearrangement; Disease mutation; Glycoprotein; Kinase; Membrane; Nucleotide-binding; Phosphoprotein; Polymorphism; Proto-oncogene; Receptor; Repeat; Signal; Transferase; Transmembrane; Tyrosine-protein kinase.
Deposited on 2008-11-05, released 2008-12-23
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.168
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08581 (0-297)
      • see remark 999 (220)
  • Chain 'B':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08581 (Start-297)
      • see remark 999 (220)
    Domains in SCOPe 2.02: d3f66b_
  • Heterogens: IHX, GBL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3f66B (B:)
    hidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavks
    lnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirn
    ethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmyd
    keyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfd
    itvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f66B (B:)
    lvqavqhvvigpsslivhfnevigrghfgcvyhgtllkkihcavkslnevsqfltegiim
    kdfshpnvlsllgiclrsplvvlpymkhgdlrnfirnethnptvkdligfglqvakgmky
    laskkfvhrdlaarncmldekftvkvadfglardmydkeyysaklpvkwmaleslqtqkf
    ttksdvwsfgvllwelmtrgappypdvntfditvyllqgrrllqpeycpdplyevmlkcw
    hpkaemrpsfselvsrisaifstfigehy