PDB entry 3f5c

View 3f5c on RCSB PDB site
Description: Structure of Dax-1:LRH-1 complex
Class: Transcription
Keywords: nuclear receptor, transcriptional corepressor, regulatory complex, DNA-binding, Lipid-binding, Metal-binding, Nucleus, Receptor, Transcription, Transcription regulation, Zinc, Zinc-finger, Cytoplasm, Repressor
Deposited on 2008-11-03, released 2008-12-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2008-12-23, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.224
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor subfamily 5 group A member 2
    Species: Mus musculus [TaxId:10090]
    Gene: Nr5a2, Lrh1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45448 (Start-247)
      • engineered (212)
    Domains in SCOPe 2.04: d3f5ca_
  • Chain 'B':
    Compound: Nuclear receptor subfamily 0 group B member 1
    Species: Mus musculus [TaxId:10090]
    Gene: Nr0b1, Ahch, Dax1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Nuclear receptor subfamily 0 group B member 1
    Species: Mus musculus [TaxId:10090]
    Gene: Nr0b1, Ahch, Dax1
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f5cA (A:)
    qtnspasiphlilellkcepdepqvqakimaylqqeqsnrnrqeklsafgllckmadqtl
    fsivewarssiffrelkvddqmkllqncwsellildhiyrqvahgkegtiflvtgehvdy
    stiishtevafnnllslaqelvvrlrslqfdqrefvclkflvlfssdvknlenlqlvegv
    qeqvnaalldytvcnypqqtekfgqlllrlpelraiskqaedylyykhvngdvpynnlli
    emlhakra
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f5cA (A:)
    asiphlilellkcepdepqvqakimaylqqeqsnrnrqeklsafgllckmadqtlfsive
    warssiffrelkvddqmkllqncwsellildhiyrqvahgkegtiflvtgehvdystiis
    htevafnnllslaqelvvrlrslqfdqrefvclkflvlfssdvknlenlqlvegvqeqvn
    aalldytvcnypqqtekfgqlllrlpelraiskqaedylyykhvngdvpynnlliemlha
    kra
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.