PDB entry 3f58

View 3f58 on RCSB PDB site
Description: igg1 fab fragment (58.2) complex with 12-residue cyclic peptide (including residues 315-324 of hiv-1 gp120 (mn isolate); h315s mutation
Class: immune system
Keywords: immunoglobulin, fab, hiv-1, gp120, v3, immune system
Deposited on 1998-10-23, released 1999-02-09
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.2
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: protein (immunoglobulin gamma I (58.2))
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3F58 (0-227)
    Domains in SCOPe 2.02: d3f58h1, d3f58h2
  • Chain 'L':
    Compound: protein (immunoglobulin gamma I (58.2))
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3F58 (0-214)
    Domains in SCOPe 2.02: d3f58l1, d3f58l2
  • Chain 'P':
    Compound: protein (cyclic peptide (gp120))
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3F58 (0-10)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3f58H (H:)
dvqlqqsgpdlvkpsqslsltctvtgysitsgyswhwirqfpgnklewmgyihysagtny
npslksrisitrdtsknqfflqlnsvttedtatyycareeampygnqayyyamdcwgqgt
tvtvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfp
avlqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3f58L (L:)
divltqspaslavslgqratisckasqgvdfdgasfmnwyqqkpgqppkllifaastles
giparfsgrgsgtdftlnihpveeedaatyycqqshedpltfgagtklelkradaaptvs
ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
stltltkdeyerhnsytceathktstspivksfnr

  • Chain 'P':
    No sequence available.