PDB entry 3f45

View 3f45 on RCSB PDB site
Description: Structure of the R75A mutant of rat alpha-Parvalbumin
Class: calcium binding protein
Keywords: calcium binding protein, EF-hand, Acetylation, Calcium, Muscle protein, Phosphoprotein
Deposited on 2008-10-31, released 2009-07-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-08-04, with a file datestamp of 2009-07-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.147
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: parvalbumin alpha
  Species: Rattus norvegicus [TaxId:10116]
  Gene: PVALB, PVA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02625 (0-108)
    • engineered (74)
  Domains in SCOPe 2.08: d3f45a_
• Heterogens: CA, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3f45A (A:)
  smtdllsaedikkaigaftaadsfdhkkffqmvglkkksaddvkkvfhildkdksgfiee
  delgsilkgfssdaadlsaketktlmaagdkdgdgkigveefstlvaes