PDB entry 3f1r

View 3f1r on RCSB PDB site
Description: Crystal structure of FGF20 dimer
Class: hormone
Keywords: beta-trefoil fold, Growth factor, Polymorphism, Secreted, HORMONE
Deposited on 2008-10-28, released 2009-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-09-01, with a file datestamp of 2009-08-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.256
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibroblast growth factor 20
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF20
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3f1ra_
  • Chain 'B':
    Compound: Fibroblast growth factor 20
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF20
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3f1rb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f1rA (A:)
    maplaevggflggleglgqqvgshfllppagerppllgerrsaaersarggpgaaqlahl
    hgilrrrqlycrtgfhlqilpdgsvqgtrqdhslfgilefisvavglvsirgvdsglylg
    mndkgelygsekltsecifreqfeenwyntyssniykhgdtgrryfvalnkdgtprdgar
    skrhqkfthflprpvdpervpelykdllmyt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f1rA (A:)
    pgaaqlahlhgilrrrqlycrtgfhlqilpdgsvqgtrqdhslfgilefisvavglvsir
    gvdsglylgmndkgelygsekltsecifreqfeenwyntyssniykhgdtgrryfvalnk
    dgtprdgarskrhqkfthflprpvdpervpelykdll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3f1rB (B:)
    maplaevggflggleglgqqvgshfllppagerppllgerrsaaersarggpgaaqlahl
    hgilrrrqlycrtgfhlqilpdgsvqgtrqdhslfgilefisvavglvsirgvdsglylg
    mndkgelygsekltsecifreqfeenwyntyssniykhgdtgrryfvalnkdgtprdgar
    skrhqkfthflprpvdpervpelykdllmyt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f1rB (B:)
    pgaaqlahlhgilrrrqlycrtgfhlqilpdgsvqgtrqdhslfgilefisvavglvsir
    gvdsglylgmndkgelygsekltsecifreqfeenwyntyssniykhgdtgrryfvalnk
    dgtprdgarskrhqkfthflprpvdpervpelykdll