PDB entry 3f12

View 3f12 on RCSB PDB site
Description: Germline V-genes sculpt the binding site of a family of antibodies neutralizing human cytomegalovirus
Class: immune system
Keywords: Human cytomegalovirus, antibody, germline, Immunoglobulin domain, IMMUNE SYSTEM
Deposited on 2008-10-27, released 2009-09-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-09-15, with a file datestamp of 2009-09-11.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.3
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: M2J1 Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3F12 (1-End)
    Domains in SCOPe 2.04: d3f12a1, d3f12a2
  • Chain 'B':
    Compound: 8f9 Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3F12
  • Chain 'C':
    Compound: M2J1 Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3F12 (1-End)
    Domains in SCOPe 2.04: d3f12c1, d3f12c2
  • Chain 'D':
    Compound: 8f9 Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3F12 (0-End)

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f12A (A:)
    meivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgip
    arfsgsgsgtdftltisslepedfavyycqqrsnwppwtfgqgtkveikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f12A (A:)
    eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisslepedfavyycqqrsnwppwtfgqgtkveiktvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3f12C (C:)
    meivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgip
    arfsgsgsgtdftltisslepedfavyycqqrsnwppwtfgqgtkveikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f12C (C:)
    eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisslepedfavyycqqrsnwppwtfgqgtkveiktvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'D':
    No sequence available.