PDB entry 3f0x

View 3f0x on RCSB PDB site
Description: Staphylococcus aureus F98Y mutant dihydrofolate reductase complexed with NADPH and 2,4-Diamino-5-[3-(3-methoxy-5-(3,5-dimethylphenyl)phenyl)but-1-ynyl]-6-methylpyrimidine
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2008-10-27, released 2009-10-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.214
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'X':
  Compound: Trimethoprim-sensitive dihydrofolate reductase
  Species: Staphylococcus aureus RF122 [TaxId:273036]
  Gene: dfrB
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q2YY41 (0-156)
    • engineered (97)
  Domains in SCOPe 2.08: d3f0xx_
• Heterogens: NDP, 53T, HOH

PDB Chain Sequences:

• Chain 'X':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3f0xX (X:)
  tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
  vltsdtsfnvegvdvihsiediyqlpghvfifggqtlyeemidkvddmyitviegkfrgd
  tffppytfedwevassvegkldekntiphtflhlirk