PDB entry 3f0s

View 3f0s on RCSB PDB site
Description: Staphylococcus aureus dihydrofolate reductase complexed with NADPH and 2,4-Diamino-5-[3-(3-methoxy-5-(3,5-dimethylphenyl)phenyl)but-1-ynyl]-6-methylpyrimidine
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2008-10-25, released 2009-10-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Trimethoprim-sensitive dihydrofolate reductase
    Species: Staphylococcus aureus RF122 [TaxId:273036]
    Gene: dfrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3f0sx_
  • Heterogens: NDP, 53T

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3f0sX (X:)
tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirk