PDB entry 3eyy

View 3eyy on RCSB PDB site
Description: Structural basis for the specialization of Nur, a nickel-specific Fur homologue, in metal sensing and DNA recognition
Class: transport
Keywords: Nur, nickel-uptake regulator, D-domain, dimerization domain, DB-domain, DNA-binding domain, TRANSPORT
Deposited on 2008-10-22, released 2009-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-23, with a file datestamp of 2009-06-19.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.218
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative iron uptake regulatory protein
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3eyya_
  • Chain 'B':
    Compound: Putative iron uptake regulatory protein
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3eyyb_
  • Heterogens: NI, ZN, CL, EDO, MLI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3eyyA (A:)
    mvstdwksdlrqrgyrltpqrqlvleavdtlehatpddilgevrktasginistvyrtle
    lleelglvshahlghgaptyhladrhhhihlvcrdctnvieadlsvaadftaklreqfgf
    dtdmkhfaifgrcescslkgsttds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eyyA (A:)
    stdwksdlrqrgyrltpqrqlvleavdtlehatpddilgevrktasginistvyrtlell
    eelglvshahlghgaptyhladrhhhihlvcrdctnvieadlsvaadftaklreqfgfdt
    dmkhfaifgrces
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3eyyB (B:)
    mvstdwksdlrqrgyrltpqrqlvleavdtlehatpddilgevrktasginistvyrtle
    lleelglvshahlghgaptyhladrhhhihlvcrdctnvieadlsvaadftaklreqfgf
    dtdmkhfaifgrcescslkgsttds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eyyB (B:)
    stdwksdlrqrgyrltpqrqlvleavdtlehatpddilgevrktasginistvyrtlell
    eelglvshahlghgaptyhladrhhhihlvcrdctnvieadlsvaadftaklreqfgfdt
    dmkhfaifgrces