PDB entry 3eyv

View 3eyv on RCSB PDB site
Description: Anti-Lewis Y Fab fragment with Lewis Y antigen in the presence of zinc ions
Class: immune system
Keywords: immunoglobulin fold, beta barrel, humanized antibody, antigen binding fragment, immune system
Deposited on 2008-10-22, released 2009-11-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.21
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hu3S193 Fab, light chain
    Species: Mus musculus, Homo sapiens [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3EYV (0-218)
    Domains in SCOPe 2.06: d3eyva1, d3eyva2
  • Chain 'B':
    Compound: hu3S193 Fab, heavy chain
    Species: Mus musculus, Homo sapiens [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3EYV (0-221)
    Domains in SCOPe 2.06: d3eyvb1, d3eyvb2
  • Chain 'H':
    Compound: hu3S193 Fab, heavy chain
    Species: Mus musculus, Homo sapiens [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3EYV (0-End)
    Domains in SCOPe 2.06: d3eyvh1, d3eyvh2
  • Chain 'L':
    Compound: hu3S193 Fab, light chain
    Species: Mus musculus, Homo sapiens [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3EYV (0-End)
    Domains in SCOPe 2.06: d3eyvl1, d3eyvl2
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3eyvA (A:)
    diqmtqspsslsasvgdrvtitcrssqrivhsngntylewyqqtpgkapklliykvsnrf
    sgvpsrfsgsgsgtdftftisslqpediatyycfqgshvpftfgqgtklqitrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3eyvB (B:)
    evqlvesgggvvqpgrslrlscstsgftfsdyymywvrqapgkglewvaymsnvgaitdy
    pdtvkgrftisrdnskntlflqmdslrpedtgvyfcargtrdgswfaywgqgtpvtvssa
    stkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssg
    lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3eyvH (H:)
    evqlvesgggvvqpgrslrlscstsgftfsdyymywvrqapgkglewvaymsnvgaitdy
    pdtvkgrftisrdnskntlflqmdslrpedtgvyfcargtrdgswfaywgqgtpvtvssa
    stkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssg
    lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eyvH (H:)
    evqlvesgggvvqpgrslrlscstsgftfsdyymywvrqapgkglewvaymsnvgaitdy
    pdtvkgrftisrdnskntlflqmdslrpedtgvyfcargtrdgswfaywgqgtpvtvssa
    stkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssg
    lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3eyvL (L:)
    diqmtqspsslsasvgdrvtitcrssqrivhsngntylewyqqtpgkapklliykvsnrf
    sgvpsrfsgsgsgtdftftisslqpediatyycfqgshvpftfgqgtklqitrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eyvL (L:)
    diqmtqspsslsasvgdrvtitcrssqrivhsngntylewyqqtpgkapklliykvsnrf
    sgvpsrfsgsgsgtdftftisslqpediatyycfqgshvpftfgqgtklqitrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnr