PDB entry 3eyq

View 3eyq on RCSB PDB site
Description: Crystal structure of MJ5 Fab, a germline antibody variant of anti-human cytomegalovirus antibody 8f9
Class: immune system
Keywords: Human cytomegalovirus, antibody, Immunoglobulin domain, IMMUNE SYSTEM
Deposited on 2008-10-21, released 2008-12-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-08-11, with a file datestamp of 2009-08-07.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.25
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: M2J5 Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3EYQ (1-End)
    Domains in SCOPe 2.04: d3eyqc1, d3eyqc2
  • Chain 'D':
    Compound: 8f9 Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3EYQ (0-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3eyqC (C:)
    meivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgip
    arfsgsgsgtdftltisslepedfavyycqqrsnwppitfgqgtrleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eyqC (C:)
    eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisslepedfavyycqqrsnwppitfgqgtrleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'D':
    No sequence available.