PDB entry 3ew9

View 3ew9 on RCSB PDB site
Description: RADA recombinase from METHANOCOCCUS MARIPALUDIS in complex with AMPPNP and potassium ions
Class: DNA binding protein, recombination
Keywords: rada, strand exchange protein, ATPase, recombinase, ATP analogue, ATP-binding, DNA damage, DNA recombination, DNA-binding, nucleotide-binding, DNA binding protein, recombination
Deposited on 2008-10-14, released 2009-05-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-07-07, with a file datestamp of 2009-07-02.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.216
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA repair and recombination protein radA
    Species: Methanococcus maripaludis [TaxId:39152]
    Gene: MMP1222, radA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q977P5 (Start-321)
      • engineered (123)
    Domains in SCOPe 2.07: d3ew9a1, d3ew9a2
  • Heterogens: ANP, MG, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ew9A (A:)
    madvltelpgvgpstadklieggyldfmkiatatigeltdiegisekaaakmimaardlc
    dlgfksgvellkqrqsvwrlstgsteldtvlaggiesqsvtefagmfgsgktqimhqtcv
    nlqmrekifadlegvveeeleapkavyidtegtfrpervvqmaegagidgqtvldntfva
    raynsdmqmlfaekiedlikggnniklviidsltstfrneftgrgklaerqqklgrhmat
    lnkladlyncivlvtnqvaakpdayfgvaeqaigghvvghaatfrfflrkskgdkrvakl
    ydsphlpdseavfritekgiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ew9A (A:)
    advltelpgvgpstadklieggyldfmkiatatigeltdiegisekaaakmimaardlcd
    lgfksgvellkqrqsvwrlstgsteldtvlaggiesqsvtefagmfgsgktqimhqtcvn
    lqmrekifadlegvveeeleapkavyidtegtfrpervvqmaegagidgqtvldntfvar
    aynsdmqmlfaekiedlikggnniklviidsltstfrneftgrgklaerqqklgrhmatl
    nkladlyncivlvtnqvaakaeqaigghvvghaatfrfflrkskgdkrvaklydsphlpd
    seavfritekgiqd