PDB entry 3ev1

View 3ev1 on RCSB PDB site
Description: Crystal Structure of Ribonuclease A in 70% Hexanediol
Class: hydrolase
Keywords: RNAse, organic solvents, multiple solvent crystal structures, Endonuclease, Glycation, Glycoprotein, Hydrolase, Nuclease, Secreted
Deposited on 2008-10-12, released 2009-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ev1a_
  • Chain 'B':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ev1b_
  • Heterogens: HEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ev1A (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ev1A (A:)
    ketaaakferqhmdsstssssnycnqmmksrnltkdrckpvntfvhesladvqavcsqkn
    vackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhfda
    sv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ev1B (B:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv