PDB entry 3eu0

View 3eu0 on RCSB PDB site
Description: Crystal structure of the S-nitrosylated Cys215 of PTP1B
Class: hydrolase
Keywords: S-nitrosylated protein, HYDROLASE, Acetylation, Endoplasmic reticulum, Membrane, Oxidation, Phosphoprotein, Polymorphism, Protein phosphatase
Deposited on 2008-10-09, released 2008-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-12-23, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.202
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine-protein phosphatase non-receptor type 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN1, PTP1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3eu0a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3eu0A (A:)
    hhhhhhmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdh
    sriklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvm
    ekgslkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhf
    hyttwpdfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclll
    mdkrkdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkel
    shedlepppehipppprppkrilephn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eu0A (A:)
    emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
    edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
    aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
    fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
    ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfim