PDB entry 3et9

View 3et9 on RCSB PDB site
Description: Crystal structure of the engineered neutralizing antibody 1H
Class: immune system
Keywords: single-chain FV, monoclonal antibody, immunoglobulin, IMMUNE SYSTEM
Deposited on 2008-10-07, released 2009-04-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-04-28, with a file datestamp of 2009-04-24.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.217
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'F':
    Compound: Antibody 1H light chain and antibody 1H heavy chain linked with a synthetic (GGGGS)4 linker
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3ET9 (5-112)
      • expression tag (4)
      • engineered (59-60)
      • engineered (111)
      • linker (113)
    • PDB 3ET9 (Start-251)
    Domains in SCOPe 2.06: d3et9f1, d3et9f2, d3et9f3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3et9F (F:)
    madykdivliqstsslsaslgdrvtiscrasqdirnylnwyqqkpdgtvklliyytsrll
    pgvpsrfsgsgsgtdysltisnleqedigtyfcqqgntlpwtfgggtkleirrggggsgg
    ggsggggsggggsevqlqqsgpelvkpgasvkisckdsgyafssswmnwvkqrpgqgpew
    igriypgdgdtnyngkfkgkatltadkssstaymqlssltsvdsavyfcarsgllryamd
    ywgqgtsvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3et9F (F:)
    kdivliqstsslsaslgdrvtiscrasqdirnylnwyqqkpdgtvklliyytsrllpgvp
    srfsgsgsgtdysltisnleqedigtyfcqqgntlpwtfgggtkleirrgqlqqsgpelv
    kpgasvkisckdsgyafssswmnwvkqrpgqgpewigriypgdgdtnyngkfkgkatlta
    dkssstaymqlssltsvdsavyfcarsgllryamdywgqgtsvtvss