PDB entry 3esu

View 3esu on RCSB PDB site
Description: Crystal structure of anthrax-neutralizing single-chain antibody 14b7
Class: immune system
Keywords: single-chain FV, monoclonal antibody, immunoglobulin, IMMUNE SYSTEM
Deposited on 2008-10-06, released 2009-04-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'F':
    Compound: Antibody 14b7* light chain and antibody 14b7* heavy chain linked with a synthetic (GGGGS)4 linker
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3ESU (3-110)
      • engineered (5-7)
      • engineered (9)
      • engineered (80)
      • engineered (109)
      • engineered (175)
    • PDB 3ESU (Start-249)
    Domains in SCOPe 2.07: d3esuf1, d3esuf2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3esuF (F:)
    dykdivliqstsslsaslgdrvtiscrasqdirnylnwyqqkpdgtvklliyytsrlqsg
    vpsrfsgsgsgtdysltisnleqedigtyfcqqgntlpwtfgggtkleirrggggsgggg
    sggggsggggsevqlqqsgpelvkpgasvkisckdsgyafssswmnwvkqrpgqgpewig
    riypgdgdtnyngkfkgkatltadkssstaymqlssltsvdsavyfcarsgllryamdyw
    gqgtsvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3esuF (F:)
    divliqstsslsaslgdrvtiscrasqdirnylnwyqqkpdgtvklliyytsrlqsgvps
    rfsgsgsgtdysltisnleqedigtyfcqqgntlpwtfgggtkleirrlqqsgpelvkpg
    asvkisckdsgyafssswmnwvkqrpgqgpewigriypgdgdtnyngkfkgkatltadks
    sstaymqlssltsvdsavyfcarsgllryamdywgqgtsvtvss