PDB entry 3esf

View 3esf on RCSB PDB site
Description: Crystal Structure of the enzyme Fe-superoxide dismutase TbSODB2 from Trypanosoma brucei
Class: oxidoreductase
Keywords: alpha/beta, Oxidoreductase
Deposited on 2008-10-05, released 2009-05-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.177
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Iron-containing superoxide dismutase B2
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: sodb2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2KN30 (0-196)
      • engineered (158)
    Domains in SCOPe 2.04: d3esfa1, d3esfa2
  • Chain 'B':
    Compound: Iron-containing superoxide dismutase B2
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: sodb2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2KN30 (0-196)
      • engineered (158)
    Domains in SCOPe 2.04: d3esfb1, d3esfb2
  • Chain 'C':
    Compound: Iron-containing superoxide dismutase B2
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: sodb2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2KN30 (0-196)
      • engineered (158)
    Domains in SCOPe 2.04: d3esfc1, d3esfc2
  • Chain 'D':
    Compound: Iron-containing superoxide dismutase B2
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: sodb2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2KN30 (0-196)
      • engineered (158)
    Domains in SCOPe 2.04: d3esfd1, d3esfd2
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3esfA (A:)
    mafsipplpwgydglaakgiskeqvtfhydkhhmgyvtklnaaansnpalaaksveeiir
    tekgpifnlaaqifnhnfywesmspngggepsgklaeairasfgsfakfkeeftnaavgh
    fgsgwawlvqdtttkklkvfqthdagcplteadlkpiltcdvwehayyidykndrpayvq
    tfwnvvnwdhaenqftr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3esfB (B:)
    mafsipplpwgydglaakgiskeqvtfhydkhhmgyvtklnaaansnpalaaksveeiir
    tekgpifnlaaqifnhnfywesmspngggepsgklaeairasfgsfakfkeeftnaavgh
    fgsgwawlvqdtttkklkvfqthdagcplteadlkpiltcdvwehayyidykndrpayvq
    tfwnvvnwdhaenqftr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3esfC (C:)
    mafsipplpwgydglaakgiskeqvtfhydkhhmgyvtklnaaansnpalaaksveeiir
    tekgpifnlaaqifnhnfywesmspngggepsgklaeairasfgsfakfkeeftnaavgh
    fgsgwawlvqdtttkklkvfqthdagcplteadlkpiltcdvwehayyidykndrpayvq
    tfwnvvnwdhaenqftr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3esfD (D:)
    mafsipplpwgydglaakgiskeqvtfhydkhhmgyvtklnaaansnpalaaksveeiir
    tekgpifnlaaqifnhnfywesmspngggepsgklaeairasfgsfakfkeeftnaavgh
    fgsgwawlvqdtttkklkvfqthdagcplteadlkpiltcdvwehayyidykndrpayvq
    tfwnvvnwdhaenqftr