PDB entry 3es7

View 3es7 on RCSB PDB site
Description: Crystal structure of divergent enolase from Oceanobacillus Iheyensis complexed with Mg and L-malate.
Class: Isomerase, lyase
Keywords: Structural genomics, NYSGRC, target 9375a, enolase superfamily, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, Isomerase, lyase
Deposited on 2008-10-04, released 2008-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-12-22, with a file datestamp of 2009-12-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.227
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Muconate cycloisomerase
    Species: Oceanobacillus iheyensis [TaxId:182710]
    Gene: OB2843
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3es7a1, d3es7a2
  • Chain 'B':
    Compound: Muconate cycloisomerase
    Species: Oceanobacillus iheyensis [TaxId:182710]
    Gene: OB2843
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3es7b1, d3es7b2
  • Heterogens: LMR, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3es7A (A:)
    mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
    lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
    ggrvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvk
    eefgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktd
    ypisehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqel
    svgtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgield
    esllakyqvpdlswdnvtvhqlqdrtadtks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3es7A (A:)
    mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
    lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
    ggrvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvk
    eefgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktd
    ypisehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqel
    svgtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgield
    esllakyqvpdlswdnvtvhqlqdrta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3es7B (B:)
    mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
    lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
    ggrvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvk
    eefgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktd
    ypisehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqel
    svgtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgield
    esllakyqvpdlswdnvtvhqlqdrtadtks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3es7B (B:)
    mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
    lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
    ggrvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvk
    eefgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktd
    ypisehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqel
    svgtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgield
    esllakyqvpdlswdnvtvhqlqdrta