PDB entry 3ert

View 3ert on RCSB PDB site
Description: human estrogen receptor alpha ligand-binding domain in complex with 4-hydroxytamoxifen
Class: nuclear receptor
Keywords: nuclear receptor, transcription factor, estrogen, antagonist
Deposited on 1999-03-30, released 1999-04-08
The last revision prior to the SCOP 1.75 freeze date was dated 1999-04-08, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.229
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (estrogen receptor alpha)
    Species: HOMO SAPIENS
    Gene: ESTROGEN RECEPTOR ALPHA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3erta_
  • Heterogens: OHT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ertA (A:)
    mdpmikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladre
    lvhminwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrn
    qgkcvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekd
    hihrvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknv
    vplydlllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ertA (A:)
    lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
    gfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveif
    dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
    lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemld
    ahrlhap