PDB entry 3erd

View 3erd on RCSB PDB site
Description: human estrogen receptor alpha ligand-binding domain in complex with diethylstilbestrol and a glucocorticoid receptor interacting protein 1 nr box II peptide
Class: nuclear receptor
Keywords: nuclear receptor, transcription factor, estrogen, agonist, coactivator
Deposited on 1999-03-31, released 1999-04-08
The last revision prior to the SCOP 1.75 freeze date was dated 1999-04-08, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.196
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (estrogen receptor alpha)
    Species: HOMO SAPIENS
    Gene: ESTROGEN RECEPTOR ALPHA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3erda_
  • Chain 'B':
    Compound: protein (estrogen receptor alpha)
    Species: HOMO SAPIENS
    Gene: ESTROGEN RECEPTOR ALPHA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3erdb_
  • Chain 'C':
    Compound: protein (glucocorticoid receptor interacting protein 1)
    Database cross-references and differences (RAF-indexed):
    • GB U39060 (Start-12)
  • Chain 'D':
    Compound: protein (glucocorticoid receptor interacting protein 1)
    Database cross-references and differences (RAF-indexed):
    • GB U39060 (0-End)
  • Heterogens: CL, DES, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3erdA (A:)
    mdpmikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladre
    lvhminwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrn
    qgkcvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekd
    hihrvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknv
    vplydlllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >3erdA (A:)
    slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
    pgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmvei
    fdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitd
    tlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydllleml
    dahrlh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3erdB (B:)
    mdpmikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladre
    lvhminwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrn
    qgkcvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekd
    hihrvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknv
    vplydlllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >3erdB (B:)
    slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
    pgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmvei
    fdmllatssrfrmmnlqgeefvclksiillnsgvytfeekdhihrvldkitdtlihlmak
    agltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemldahrlh
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.