PDB entry 3eqz

View 3eqz on RCSB PDB site
Description: Crystal structure of a response regulator from Colwellia psychrerythraea
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, UNKNOWN FUNCTION, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2008-10-01, released 2008-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1940
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q483U6 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d3eqza1, d3eqza2
  • Chain 'B':
    Compound: Response regulator
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1940
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q483U6 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3eqzb1, d3eqzb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3eqzA (A:)
    mslnrvfivdddtltcnllktivepifgnveafqhprafltlslnkqdiiildlmmpdmd
    gievirhlaehkspaslilisgydsgvlhsaetlalscglnvintftkpintevltcflt
    slsnrqaeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eqzA (A:)
    lnrvfivdddtltcnllktivepifgnveafqhprafltlslnkqdiiildlmmpdmdgi
    evirhlaehkspaslilisgydsgvlhsaetlalscglnvintftkpintevltcfltsl
    snrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3eqzB (B:)
    mslnrvfivdddtltcnllktivepifgnveafqhprafltlslnkqdiiildlmmpdmd
    gievirhlaehkspaslilisgydsgvlhsaetlalscglnvintftkpintevltcflt
    slsnrqaeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eqzB (B:)
    slnrvfivdddtltcnllktivepifgnveafqhprafltlslnkqdiiildlmmpdmdg
    ievirhlaehkspaslilisgydsgvlhsaetlalscglnvintftkpintevltcflts
    lsnrq