PDB entry 3eqp

View 3eqp on RCSB PDB site
Description: Crystal Structure of Ack1 with compound T95
Class: Transferase
Keywords: ack1, Alternative splicing, ATP-binding, Cell membrane, Kinase, Magnesium, Membrane, Metal-binding, Nucleotide-binding, Phosphoprotein, Polymorphism, SH3 domain, Transferase, Tyrosine-protein kinase
Deposited on 2008-10-01, released 2008-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-02, with a file datestamp of 2009-05-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.224
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Activated CDC42 kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TNK2, ACK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3eqpa_
  • Chain 'B':
    Compound: Activated CDC42 kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TNK2, ACK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3eqpb_
  • Heterogens: T95, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3eqpA (A:)
    ltcligekdlrlleklgdgsfgvvrrgewdapsgktvsvavkclkpdvlsqpeamddfir
    evnamhsldhrnlirlygvvltppmkmvtelaplgslldrlrkhqghfllgtlsryavqv
    aegmgyleskrfihrdlaarnlllatrdlvkigdfglmralpqnddhyvmqehrkvpfaw
    capeslktrtfshasdtwmfgvtlwemftygqepwiglngsqilhkidkegerlprpedc
    pqdiynvmvqcwahkpedrptfvalrdflleaqptd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eqpA (A:)
    ltcligekdlrlleklgdgsfgvvrrgewdapsgktvsvavkclqpeamddfirevnamh
    sldhrnlirlygvvltppmkmvtelaplgslldrlrkhqghfllgtlsryavqvaegmgy
    leskrfihrdlaarnlllatrdlvkigdfglmralpqnddhyvmqehrkvpfawcapesl
    ktrtfshasdtwmfgvtlwemftygqepwiglngsqilhkidkegerlprpedcpqdiyn
    vmvqcwahkpedrptfvalrdflleaqp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3eqpB (B:)
    ltcligekdlrlleklgdgsfgvvrrgewdapsgktvsvavkclkpdvlsqpeamddfir
    evnamhsldhrnlirlygvvltppmkmvtelaplgslldrlrkhqghfllgtlsryavqv
    aegmgyleskrfihrdlaarnlllatrdlvkigdfglmralpqnddhyvmqehrkvpfaw
    capeslktrtfshasdtwmfgvtlwemftygqepwiglngsqilhkidkegerlprpedc
    pqdiynvmvqcwahkpedrptfvalrdflleaqptd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eqpB (B:)
    ltcligekdlrlleklgdgsfgvvrrgewdapsgktvsvavkclqpeamddfirevnamh
    sldhrnlirlygvvltppmkmvtelaplgslldrlrkhqghfllgtlsryavqvaegmgy
    leskrfihrdlaarnlllatrdlvkigdfglmralpqnddhyvmqehrkvpfawcapesl
    ktrtfshasdtwmfgvtlwemftygqepwiglngsqilhkidkegerlprpedcpqdiyn
    vmvqcwahkpedrptfvalrdflleaqptd