PDB entry 3eot

View 3eot on RCSB PDB site
Description: Crystal structure of LAC031, an engineered anti-VLA1 Fab
Class: immune system
Keywords: antibody, Fab, VLA-1, domain swap, proten engineering, IMMUNE SYSTEM
Deposited on 2008-09-29, released 2009-01-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-04-07, with a file datestamp of 2009-04-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.234
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab fragment, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3EOT (0-End)
  • Chain 'L':
    Compound: Fab fragment, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3EOT (0-End)
    Domains in SCOPe 2.06: d3eotl1, d3eotl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3eotL (L:)
    qiqltqspsslsasvgdrvtitcsasssvnssalfwyqqkpgkapkpwiyltsnlasgvp
    srfsgsgsgtdytltisslqpedfatyycqqisgnpwtfgqgtkveikradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eotL (L:)
    qiqltqspsslsasvgdrvtitcsasssvnssalfwyqqkpgkapkpwiyltsnlasgvp
    srfsgsgsgtdytltisslqpedfatyycqqisgnpwtfgqgtkveikradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrne