PDB entry 3eon

View 3eon on RCSB PDB site
Description: 2.55A crystal structure of native glutaryl-coa dehydrogenase from Burkholderia pseudomallei in complex with a small molecule
Class: oxidoreductase
Keywords: burkholderia, pseudomallei, glutaryl-coa, dehydrogenase, seattle structural genomics center for infectious disease, ssgcid, oxidoreductase
Deposited on 2008-09-28, released 2008-10-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-09-21, with a file datestamp of 2011-09-16.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.191
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710B_2458, BURPS1710b_3237, MSRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3eona1, d3eona2
  • Chain 'B':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710B_2458, BURPS1710b_3237, MSRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3eonb1, d3eonb2
  • Chain 'C':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710B_2458, BURPS1710b_3237, MSRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3eonc1, d3eonc2
  • Chain 'D':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710B_2458, BURPS1710b_3237, MSRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3eond1, d3eond2
  • Heterogens: 341, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3eonA (A:)
    smaaatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremg
    eigllgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaq
    kekylpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspiadvf
    vvwakldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilph
    vkglrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladm
    qteitlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisdefg
    varhlvnlevvntyegthdihalilgraqtgiqaff
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eonA (A:)
    atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl
    lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky
    lpklatgewigcfgltepnpgsmvtrarkvpggyslsgskmwitnspiadvfvvwaklde
    dgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkglrgpf
    tclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqteitlgl
    qgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisdefgvarhlvnl
    evvntydihalilgraqtgiqaf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3eonB (B:)
    smaaatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremg
    eigllgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaq
    kekylpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspiadvf
    vvwakldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilph
    vkglrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladm
    qteitlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisdefg
    varhlvnlevvntyegthdihalilgraqtgiqaff
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eonB (B:)
    atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl
    lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky
    lpklatgewigcfgltepngsmvtrarkvpggyslsgskmwitnspiadvfvvwaklded
    eirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkglrgpftcln
    sarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqteitlglqgvl
    rlgrmkdegtaaveitsimkrnscgkaldiarlardmlgfgvarhlvnlevvntyegthd
    ihalilgraqtgiqa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3eonC (C:)
    smaaatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremg
    eigllgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaq
    kekylpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspiadvf
    vvwakldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilph
    vkglrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladm
    qteitlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisdefg
    varhlvnlevvntyegthdihalilgraqtgiqaff
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eonC (C:)
    atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl
    lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky
    lpklatgewigcfgltepgsmvtrarkvpggyslsgskmwitnspiadvfvvwakldedg
    rdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkglrgpftc
    lnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqteitlglqg
    vlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngdefgvarhlvnlevvn
    tyegthdihalilgraqtgiqa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3eonD (D:)
    smaaatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremg
    eigllgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaq
    kekylpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspiadvf
    vvwakldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilph
    vkglrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladm
    qteitlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisdefg
    varhlvnlevvntyegthdihalilgraqtgiqaff
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eonD (D:)
    aatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeig
    llgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkek
    ylpklatgewigcfglteppgsmvtrarkvpggyslsgskmwitnspiadvfvvwakldd
    eirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkglrgpftcln
    sarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqteitlglqgvl
    rlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngsdefgvarhlvnlevvnt
    yedihalilgraqtgiqaff